Conserved Protein Domain Family
PRK05927

?
PRK05927: PRK05927 
dehypoxanthine futalosine cyclase
Statistics
?
PSSM-Id: 135660
View PSSM: PRK05927
Aligned: 14 rows
Threshold Bit Score: 735.92
Threshold Setting Gi: 15834768
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15605500    1 MGSPARTSFQEGLRLFLYSPLEELRIHADSLRKQRYPQNTITYVLDANPNYTNICKIDCAFCAFYRKPRSSDAYLLSFDE 80 
166154109   1 MGSPARTSFQEGLRLFLYSPLEELRIHADSLRKQRYPQNTITYVLDANPNYTNICKIDCAFCAFYRKPRSSDAYLLSFDE 80 
166154984   1 MGSPARTSFQEGLRLFLYSPLEELRIHADSLRKQRYPQNTITYVLDANPNYTNICKIDCAFCAFYRKPRSSDAYLLSFDE 80 
237803197   1 MGSPARTSFQEGLRLFLYSPLEELRIHADSLRKQRYPQNTITYVLDANPNYTNICKIDCAFCAFYRKPHSSNAYLLSFDE 80 
237805118   1 MGSPARTSFQEGLRLFLYSPLEELRIHADSLRKQRYPQNTITYVLDANPNYTNICKIDCAFCAFYRKPHSSNAYLLSFDE 80 
62185426    1 MNLFTRISFDEGLELFRTSPLEKLQEAANILRKQRHPGNKVTYVLDANPNYTNICKIDCTFCAFYRKPHASDAYLLSFDK 80 
89897966    1 MNLFTRISFDEGLELFRTSPLEKLQEVANILREQRYPDNKVTYVLDANPNYTNICKIDCTFCAFYRKPHSSDAFLLSFDE 80 
29840614    1 MNLSTRISFDKGLELFRTSPLEKLQEVANILREQRYPDNKVTYVLDANPNYTNICKIDCTFCAFYRKPRSADAFLLSFDE 80 
16752125    1 MNLCKRISFEEGLELFVSSPIERLQERADAIRKERYPSNEVTYVLDANPNYTNICKIDCTFCAFYRKPKSPDAYLLSFDE 80 
15618820    1 MNLCKRISFEEGLELFVSSPIERLQERADAIRKERYPSNEVTYVLDANPNYTNICKIDCTFCAFYRKPKSPDAYLLSFDE 80 
15605500   81 FRQLMQRYVQAGIKTVLLQGGVHPQIGIDYLETLVSITKKEFPSLHPHFFSAVEIAHAAQISGISTEQALERLWEAGQRT 160
166154109  81 FRQLMQRYVQAGIKTVLLQGGVHPQIGIDYLETLVSITKKEFPSLHPHFFSAVEIAHAAQISGISTEQALERLWEAGQRT 160
166154984  81 FRQLMQRYVQAGIKTVLLQGGVHPQIGIDYLETLVSITKKEFPSLHPHFFSAVEIAHAAQISGISTEQALERLWEAGQRT 160
237803197  81 FRQLMQRYVQAGIKTVLLQGGVHPQIGIDYLETLVSITKKEFPSLHPHFFSAVEIAHAAQISGISTEQALERLWEAGQRT 160
237805118  81 FRQLMQRYVQAGIKTVLLQGGVHPQIGIDYLETLVSITKKEFPSLHPHFFSAVEIAHAAQISGISTEQALERLWEAGQRT 160
62185426   81 FRSLMQRYISMGVKTVLLQGGVHPQLGIDYLEEFVRITVQEFPSIHPHFFSAVEISHAASVSGISNEEALMRLWNAGQRT 160
89897966   81 FRSLMQRYIALGVKTVLLQGGVHPSLGMDYLAEFVRITVKEFPSIHPHFFSAVEISHAASVSGISNEKALGMLWDAGQRT 160
29840614   81 FRSLMQRYISMGVKTVLLQGGVHPRLGVDYLEEFVRITVKEFPSLHPHFFSAVEIAHAATVSGVSTEEALGRLWDAGQRT 160
16752125   81 VRSLLQRYVSSGVKTVLLQGGVHPGLGIDYLEELVRITVQEFPSIHPHFFSAVEIEHACRVSGISIEQGLQRLWDAGQRT 160
15618820   81 VRSLLQRYVSSGVKTVLLQGGVHPGLGIDYLEELVRITVQEFPSIHPHFFSAVEIEHACRVSGISIEQGLQRLWDAGQRT 160
15605500  161 IPGGGAEILSERIRKQISPKKMGPDGWIQFHKLAHRLGFRSTATMMFGHVESPEDILLHLQTLRDAQDENPGFFSFIPWS 240
166154109 161 IPGGGAEILSERIRKQISPKKMGPDGWIQFHKLAHRLGFRSTATMMFGHVESPEDILLHLQTLRDAQDENPGFFSFIPWS 240
166154984 161 IPGGGAEILSERIRKQISPKKMGPDGWIQFHKLAHRLGFRSTATMMFGHVESPEDILLHLQTLRDAQDENPGFFSFIPWS 240
237803197 161 IPGGGAEILSERIRKQISPKKMGPDGWIQFHKLAHRLGFRSTATMMFGHVESPEDILLHLQTLRDAQDENPGFFSFIPWS 240
237805118 161 IPGGGAEILSERIRKQISPKKMGPDGWIQFHKLAHRLGFRSTATMMFGHVESPEDILLHLQTLRDAQDENPGFFSFIPWS 240
62185426  161 IPGGGAEIFSERVRKIISPKKMGPDGWINFHKLAHRLGFYSTATMMFGHIENAHDILLHLQALRDAQDETPGFYSFIPWS 240
89897966  161 IPGGGAEILSERVRKILSPKKIGPDGWISFHKLAHCLGFRSTATMMFGHVENAHDILLHLEALRNAQDEVPGFYSFIPWS 240
29840614  161 IPGGGAEILSERVRKIVSPKKMGPDGWINFHKLAHRLGFRTTATMMFGHIETAHDILLHLETLRNAQDETPGFYSFIPWS 240
16752125  161 IPGGGAEILSERVRKIISPKKMQPGGWINLHKLAHLMGFRTTATMMFGHVENPEDILIHLQTLRDAQDSCPGFYSFIPWS 240
15618820  161 IPGGGAEILSERVRKIISPKKMQPGGWINLHKLAHLMGFRTTATMMFGHVENPEDILIHLQTLRDAQDSCPGFYSFIPWS 240
15605500  241 YKPNNTALGRRVPHQASPELYYRILAVARIFLDNFDHIAASWFGEGKEEGVKGLFYGADDFGGTILDESVHKCTGWDLQS 320
166154109 241 YKPNNTALGRRVPHQASPELYYRILAVARIFLDNFDHIAASWFGEGKEEGVKGLFYGADDFGGTILDESVHKCTGWDLQS 320
166154984 241 YKPNNTALGRRVPHQASPELYYRILAVARIFLDNFDHIAASWFGEGKEEGVKGLFYGADDFGGTILDESVHKCTGWDLQS 320
237803197 241 YKPNNTALGRRVPHQASPELYYRILAVARIFLDNFDHIAASWFGEGKEEGVKGLFYGADDFGGTILDESVHKCTGWDLQS 320
237805118 241 YKPNNTALGRRVPHQASPELYYRILAVARIFLDNFDHIAASWFGEGKEEGVKGLFYGADDFGGTILDESVHKCTGWDLQS 320
62185426  241 YKSGNTALGRKVPNQAPPEMYYRILALARIFLDNFEHIAASWFGEGKEHGARGLHYGADDFGGTIIDESVHKCAGWTLKS 320
89897966  241 YKSGNTALGRKVPHQAPPEMYYRILAVARIFLDNFDHIAASWFGEGKELGARGLHYGADDFGGTIIDESVHRCTGWTLKS 320
29840614  241 YKSGNTALGRKVPNQAAPEMYYRILALSRIFLDNFEHIAASWFGEGKEYGARGLHYGADDFGGIIIDESVHKCTGWTLKS 320
16752125  241 YKPGNTALRRNVPQQASIETYYRILALGRIFLDNFDHVAASWFGEGKSLGAKALHYGADDFGGVILDESVHKATGWSIQS 320
15618820  241 YKPGNTALRRNVPQQASIETYYRILALGRIFLDNFDHVAASWFGEGKSLGAKALHYGADDFGGVILDESVHKATGWSIQS 320
15605500  321 SEKEICAMLLQAGFTPVERDTFYRPLSLAR 350
166154109 321 SEKEICAMLLQAGFTPVERDTFYRPLSLAR 350
166154984 321 SEKEICAMLLQAGFTPVERDTFYRPLSLAR 350
237803197 321 SEKEICAMLLQAGFTPVERDTFYRPLSLAR 350
237805118 321 SEKEICAMLLQAGFTPVERDTFYRPLSLAR 350
62185426  321 SEEETRTMIASEGFIPVERNTFYEPIETPS 350
89897966  321 SEEEARAIIASEGFIPVERNTFYERIETPA 350
29840614  321 SEEEARAMIASEGFIPVERNTFYEHIEIPA 350
16752125  321 SEEEICNIIRSEGFIPVERNTFYQHISCTV 350
15618820  321 SEEEICNIIRSEGFIPVERNTFYQHISCTV 350
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap