Conserved Protein Domain Family
PRK05926

?
PRK05926: PRK05926 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 168296
View PSSM: PRK05926
Aligned: 14 rows
Threshold Bit Score: 720.48
Threshold Setting Gi: 33241865
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
62184869    1 MTITPPRILPKNSWMKHVFDKYMERVRLSKEDALRLLLLeDEVDQRALWAFADLVRQKYVGDVVYYSSTFYLYPTNFCEF 80 
15605153    1 MTTLPARILPKSACLKTLFDDYLSGARLSEEQALQLLLV-DAEDQQALWSFADLIRANRVGDTVFYSSTLYLYPTNFCQF 79 
76789160    1 MTTLPARILPKSACLKTLFDDYLSGARLSEEQALQLLLV-DAEDQQALWSFADLIRANRVGDTVFYSSTLYLYPTNFCQF 79 
166155514   1 MTTLPARILPKSAWLKTLFDDYLSGARLSEKQALQLLLV-DAEDQQALWSFADLIRANRVGDTVFYSSTLYLYPTNFCQF 79 
237802853   1 MTTLPARILPKSACLKTLFDDYLSGARLSEEQALQLLLV-DAEDQQALWSFADLIRANRVGDTVFYSSTLYLYPTNFCQF 79 
237804775   1 MTTLPARILPKSACLKTLFDDYLSGARLSEEQALQLLLV-DAEDQQALWSFADLIRANRVGDTVFYSSTLYLYPTNFCQF 79 
89898583    2 TTTPLPRILLKNSWMKQLFDTYTEGARLSTDEALRLLLLeNEDDQRALWDFADQVRKKYVGDVVYYSSTFYLYPTNFCDF 81 
29839997    2 TTAHIPRILPKNSWLKHLFDNYMGGARLSKEDALRLLLIeDEDDQRALWAFANTIRHKYVGDIVYYSSTFYLYPTNFCEF 81 
16752529    2 TTCLPQP--PKTSPLYSIFEKLDAQERLSSEDALHLLLLtNKEDQRTLWNFADQVRKQRVGDTVYYSSTLYLYPTNFCDF 79 
15618424    2 TTCLPQP--PKTSPLYSIFEKLDAQERLSSEDALHLLLLtNKEDQRTLWNFADQVRKQRVGDTVYYSSTLYLYPTNFCDF 79 
62184869   81 NCTFCAFYAKPGDPKGWFHTPDQLIEKIQELDVPITETHIVGGCFPDCDLDYYTELFSKIKAHFPHLHVKALTGIEYAYL 160
15605153   80 NCTFCSFYAKPGNPTGWFFTPDQLVQSIKENPSPITETHIVAGCYPSCNLAYYEELFSKIKQNFPDLHIKALSAIEYDYL 159
76789160   80 NCTFCSFYAKPGNPTGWFFTPDQLVQSIKENPSPITETHIVAGCYPSCNLAYYEELFSKIKQNFPDLHIKALSAIEYDYL 159
166155514  80 NCTFCSFYAKPGNPTGWFFTPDQLVQSIKENPSPITETHIVAGCYPSCNLAYYEELFSKIKQNFPDLHIKALSAIEYDYL 159
237802853  80 NCTFCSFYAKPGNPTGWFFTPDQLVQSIKENPSPITETHIVAGCYPSCNLAYYEELFSKIKQNFPDLHIKALSAIEYDYL 159
237804775  80 NCTFCSFYAKPGNPTGWFFTPDQLVQSIKENPSPITETHIVAGCYPSCNLAYYEELFSKIKQNFPDLHIKALSAIEYDYL 159
89898583   82 NCTFCAFYAKPGDAKGWFYTPDQLIQKIHELDVPVTEAHIVSGCFPECNLDYYTELFRKIKTNFPHIHIKALTGIEYAYL 161
29839997   82 NCTFCAFYAKPGDAKGWFYTPNQLIEKIRALDVPITETHIVAGCSPECNLDYYTELFSKIKENFPHIHIKALTGIEYAYL 161
16752529   80 SCKFCSFYAKPGDPKGWLYSPDDLLQQIQNIKTPITEVHIVGGCFPSCNLQYYSDLFTKIKEYDPQIHIKALTAIEYAYL 159
15618424   80 SCKFCSFYAKPGDPKGWLYSPDDLLQQIQNIKTPITEVHIVGGCFPSCNLQYYSDLFTKIKEYDPQIHIKALTAIEYAYL 159
62184869  161 ANLHNIPVVEVLQTLKNAGLDSIPGGGFDILVDEIRQKLAPGRLSSQEFLEIHRTAHGLDIPTNSTMLCYHRERPEDIVT 240
15605153  160 SKLDNLPVKEVMQRLRIAGLDSIPGGGAEILVDEVRETLSRGRLSSQGFLEIHETAHSLGIPSNATMLCYHRETPADIMT 239
76789160  160 SKLDNLPVKEVMQRLRIAGLDSIPGGGAEILVDEVRETLSRGRLSSQGFLEIHETAHSLGIPSNATMLCYHRETPADIMT 239
166155514 160 SKLDNLPVKEVMQRLRIAGLDSIPGGGAEILVDEVRETLSRGRLSSQGFLEIHETAHSLGIPSNATMLCYHRETPADIMT 239
237802853 160 SKLDNLPVKEVMQRLRIAGLDSIPGGGAEILVDEVRETLSRGRLSSQGFLEIHETAHSLGIPSNATMLCYHRETPADIMT 239
237804775 160 SKLDNLPVKEVMQRLRIAGLDSIPGGGAEILVDEVRETLSRGRLSSQGFLEIHETAHSLGIPSNATMLCYHRETPADIMT 239
89898583  162 AQLHNIPVVEVLKILKNSGLDSIPGGGFDILVDEIRQVLAPGRLSSQAFLDIHRTAHNLGIPSNSTMLCYHREKPEDLVT 241
29839997  162 ANLHNIPVVEVLKTLKNAGLDSIPGGGFDILVDEIRQILAPGRLSSQDFLEIHKTAHNLGIPSNSTMLCYHRERPEDIVT 241
16752529  160 SDLDNLSIRDVLLTLKDAGLDSIPGGGAEILVDKIRNFLAPKRLSSSDFLNIHKMAHQLGIHSNITMLCYHKEGPEDLVT 239
15618424  160 SDLDNLSIRDVLLTLKDAGLDSIPGGGAEILVDKIRNFLAPKRLSSSDFLNIHKMAHQLGIHSNITMLCYHKEGPEDLVT 239
62184869  241 HMDKLRNLQDDTLGFKNFILLKFATENNALGKRLRKLGTSHHIPPASIIAVARLFLDNFRNIKALWNYLGIEQALHLLSC 320
15605153  240 HMSKLRALQDKTSGFKNFILLKFASENNALGKRLHKMTSRHSIPPATIIAVARLFLDNIPNIKALWNYLGLDVALHLLSC 319
76789160  240 HMSKLRALQDKTSGFKNFILLKFASENNALGKRLHKMTSRHSIPPATIIAVARLFLDNIPNIKALWNYLGLDVALHLLSC 319
166155514 240 HMSKLRALQDKTSGFKNFILLKFASENNALGKRLHKMTSRHSIPPATIIAVARLFLDNIPNIKALWNYLGLDVALHLLSC 319
237802853 240 HMSKLRALQDKTSGFKNFILLKFASENNALGKRLHKMTSRHSIPPATIIAVARLFLDNIPNIKALWNYLGLDVALHLLSC 319
237804775 240 HMSKLRALQDKTSGFKNFILLKFASENNALGKRLHKMTSRHSIPPATIIAVARLFLDNIPNIKALWNYLGLDVALHLLSC 319
89898583  242 HMEKLRNLQDDTLGFKNFVLLKFATENNPLGKRLRKIGRFHNIPPASIIAVARLFLDNFRNIKALWNYLGIEQALHLLSC 321
29839997  242 HMDKLRSLQDDTLGFKNFVLLKFATENNPLGKRLRKLGGSHNIPPASIIAVARLFLDNFRNIKALWNYLGIEQALHLLSC 321
16752529  240 HMVKVRDLQDETQGFKNFILLKFAQENNVLGKRLRKSGQGHAIPLKSLMAVARIFLDNFSNMKALWNYLGIEAALDLLSC 319
15618424  240 HMVKVRDLQDETQGFKNFILLKFAQENNVLGKRLRKSGQGHAIPLKSLMAVARIFLDNFSNMKALWNYLGIEAALDLLSC 319
62184869  321 GANDLSSTHLGEKVFQMASSNQSIKMDIEGMASLITKLGRIPCLTNSKDV 370
15605153  320 GANDLSSTHQGEKVFRMASSQEPIRMDIEGMSHLIIQHGRIPCLVNSKTV 369
76789160  320 GANDLSSTHQGEKVFRMASSQEPIRMDIEGMSHLIIQHGRIPCLVNSKTV 369
166155514 320 GANDLSSTHQGEKVFRMASSQEPIRMDIEGMSHLIIQHGRIPCLVNSKTV 369
237802853 320 GANDLSSTHQGEKVFRMASSQEPIRMDIEGMSHLIIQHGRIPCLVNSKTV 369
237804775 320 GANDLSSTHQGEKVFRMASSQEPIRMDIEGMSHLIIQHGRIPCLVNSKTV 369
89898583  322 GANDLSSTHIGEKVFQMASSNQSIKMDIEGMASLIKKQGRIPCLTNSKDV 371
29839997  322 GANDFSSTHIGEKVFQMASSNQNIKMDIEGMANLIKEQGRIPCLTNSKDV 371
16752529  320 GANDLSSTHMGEKVFQMASSKEPIKMDAEGMAALITQQGRTPCLTNSSHV 369
15618424  320 GANDLSSTHMGEKVFQMASSKEPIKMDAEGMAALITQQGRTPCLTNSSHV 369
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap