Conserved Protein Domain Family
PRK05917

?
PRK05917: PRK05917 
DNA polymerase III subunit delta'; Validated
Statistics
?
PSSM-Id: 102059
View PSSM: PRK05917
Aligned: 14 rows
Threshold Bit Score: 416.504
Threshold Setting Gi: 33241614
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15604907    1 MESAAWEALIQRVRDQKLPSAIILHGQDLSNLSARAYEYASLIIKETLPEAAYKLANKLHPDMHEYSPQGKGRLHTIETP 80 
76788909    1 MESAAWEALIQRVRDQKLPSAIILHGQDLSNLSARAYEYASLIIKETLPEAAYKLANKLHPDMHEYSPQGKGRLHTIETP 80 
166155272   1 MESAAWEALIQRVRDQKLPSAIILHGQDLSNLSARAYEYASLIIKETLPEAAYKLANKLHPDIHEYSPQGKGRLHTIETP 80 
237802611   1 MESAAWEALIQRVRDQKLPSAIILHGQDLSNLSARAYEYASLIIKETLPEAAYKLANKLHPDMHEYSPQGKGRLHTIETP 80 
237804533   1 MESAAWEALIQRVRDQKLPSAIILHGQDLSNLSARAYEYASLIIKETLPEAAYKLANKLHPDMHEYSPQGKGRLHTIETP 80 
62185124    1 -----------------------MHGSSLSILSQYAYTLASHILLRDTPEAQYKISQKIHPDIQEFLPSGKGRLHSIEIP 57 
89898306    7 VINEPWEVLLDSVNQGKIPHAILLHGNSLTMLSQYAYNLAANILVKEFPEAQYKISKKIHPDIHELVPEGKGRLHSIEVP 86 
29840269    7 VDNDPWEALLDNINQGKVSHAILLHGNALSLLSQYAYDLAAHILIKDTPEAQYKITQRVHPDIHEFFPSGKGRLHPIEIP 86 
16752766    5 EENQGWEALLRKVYHQEVPPAILLHGFTLPVLQDKAEQLASEILLSSSPGSEHKVSQKIHPDIYQFFPEGKGRLHSIDLP 84 
15618192    5 EENQGWEALLRKVYHQEVPPAILLHGFTLPVLQDKAEQLASEILLSSSPGSEHKVSQKIHPDIYQFFPEGKGRLHSIDLP 84 
15604907   81 RAIRKDIWIHPYESPYKIYIIYEADRITLDAISAFLKLLEDPPQYGMFILVSALPQRLPPTIRSRCVSFRIPMEEKTLVS 160
76788909   81 RAIRKDIWIHPYESPYKIYIIYEADRITLDAISAFLKLLEDPPQYGMFILVSALPQRLPPTIRSRCVSFRIPMEEKTLVS 160
166155272  81 RAIRKDIWIHPYESPYKIYIIYEADRITLDAISAFLKLLEDPPQYGMFILVSALPQRLPPTIRSRCVSFHIPMEEKTLVS 160
237802611  81 RAIRKDIWIHPYESPYKIYIIYEADRITLDAISAFLKLLEDPPQYGMFILVSALPQRLPPTIRSRCVSFRIPMEEKTLVS 160
237804533  81 RAIRKDIWIHPYESPYKIYIIYEADRITLDAISAFLKLLEDPPQYGMFILVSALPQRLPPTIRSRCVSFRIPMEEKTLVS 160
62185124   58 RDIKKQIAILPYEGHYKIYIIHEVDRMTLPAISVFLKVLEEAPSHNVILLTSAKLQRIPATILSRSLSIHIQGQDKTLPN 137
89898306   87 RDIKRQIGVLPYEASYKIYIIHEVDRMTLPAISAFLKVLEDAPPHSVIILTSTKLQRIPATILSRSFSLYIQGEEHRDPN 166
29840269   87 RDIKKQIGVLPYEGCYKIYIIHEVDRMTLPAISVFLKVLEDAPAHSVILLTSAKLQRIPATILSRSLSIYIQGKENVAPN 166
16752766   85 RGIKKQIYISPFEANYKIYIIHEADRMTLAAISAFLKVFEEPPKHAVIILTTAKVQRLPKTIISRSLSIFIERGEKILCS 164
15618192   85 RGIKKQIYISPFEANYKIYIIHEADRMTLAAISAFLKVFEEPPKHAVIILTTAKVQRLPKTIISRSLSIFIERGEKILCS 164
15604907  161 KKDIAFLIGLAQGKESVTRIGSQVKGTADEDKQVLRDKTKAMLTVLLQLFRDRFLLAKKVPVSLLAYPDLLNEIKTMPVY 240
76788909  161 KKDIAFLIGLAQGKESVTRIGSQVKGTADEDKQVLRDKTKAMLTVLLQLFRDRFLLAKKVPVSLLAYPDLLNEIKTMPVY 240
166155272 161 KKDIAFLIGLAQGKESVTRIGSQVKGTADEDKQVLRDKTKAMLTVLLQLFRDRFLLAKKVPVSLLAYPDLLNEIKTMPVY 240
237802611 161 KKDIAFLIGLAQGKESVTRIGSQVKGTADEDKQVLRDKTKAMLTVLLQLFRDRFLLAKKVPVSLLAYPDLLNEIKTMPVY 240
237804533 161 KKDIAFLIGLAQGKESVTRIGSQVKGTADEDKQVLRDKTKAMLTVLLQLFRDRFLLAKKVPVSLLAYPDLLNEIKTMPVY 240
62185124  138 EEEIAYLLKYASGEMSITEVGKIVKGSVDTDKQVLRDKAKYLLEVLLTLFRDRFILSLNVSASAMTYPQYAKGILNLPVL 217
89898306  167 KEDVAYLLKYASGKMKITEAGQIVKGGADADKQMLRDKAKRLLEVLLMLFRDRFMLSLNMSASAMTYPQYAKDILNLPAL 246
29840269  167 EEDIEYLLNYASGKMKITEVGQIVKGNADTDKQVLRDKAKVLLEILLKLFRDRFMLSLNIPASALAYPKYAKDILNLPIL 246
16752766  165 KETFSYLFRYAQCEIPVTEVSQIIKESSETDKQVLRDKVQRFMEVLLELYRDRYTLNLGLKASALNYPEHVKEILQLPLL 244
15618192  165 KETFSYLFRYAQCEIPVTEVSQIIKESSETDKQVLRDKVQRFMEVLLELYRDRYTLNLGLKASALNYPEHVKEILQLPLL 244
15604907  241 PLEEVLSIITRAVQALDSYSSAPSCLEWICLQLWSFKNRQQMAIRNRRRS 290
76788909  241 PLEEVLSIITRAVQALDSYSSAPSCLEWICLQLWSFKNRQQMAIRNRRRS 290
166155272 241 PLEEVLSIITRAVQALDSYSSAPSCLEWICLQLWSFKNRQQMAIRNRRRS 290
237802611 241 PLEEVLSIITRAVQALDSYSSAPSCLEWICLQLWSFKNRQQMAIRNRRRS 290
237804533 241 PLEEVLSIITRAVQALDSYSSAPSCLEWICLQLWSFKNRQQMAIRNRRRS 290
62185124  218 PLEKVLVIIEKAYQALDNSSSATSCMEWVALQLASLNHRSSILTERTCP- 266
89898306  247 PLEKVLIVIEKAYRSLDNSSSATSCMEWVALQLASLSHRSSMLV------ 290
29840269  247 PLEKVLIIIEKAHQALDNSSSATSCMEWVALQLVSLNNRLAR-------- 288
16752766  245 PLDKVLLIVESACRSLNNSSSAASVLEWVAIQLVSLQYKEKELVSVSPGQ 294
15618192  245 PLDKVLLIVESACRSLNNSSSAASVLEWVAIQLVSLQYKEKELVSVSPGQ 294
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap