Conserved Protein Domain Family
PRK05910

?
PRK05910: PRK05910 
type III secretion system protein; Validated
Statistics
?
PSSM-Id: 168293
View PSSM: PRK05910
Aligned: 14 rows
Threshold Bit Score: 925.732
Threshold Setting Gi: 166154281
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
62185043    1 MVTSKQEKLWRMALIPLGILLSFLIPLPQLLLDTGLCINFILSLTVVFWVFSLKSSLEARLFPALFVYLCLFRLGLNLAS 80 
15604779   27 VVNNFRGSSWKIVAIPSCILFTLIFHLPRWLIDFGVCTNLACSLSIIFWVFSLRSSASARIFPSLLLYLCLLRLGLNLAS 106
76788773   27 VVNNFRGSSWKIVAIPSCILFTLIFHLPRWLIDFGVCTNLACSLSIIFWVFSLRSSASARIFPSLLLYLCLLRLGLNLAS 106
166155156  27 VVNNFRGSSWKIVAIPSCILFTLIFHLPRWLIDFGVCTNLACSLSIIFWVFSLRSSASARIFPSLLLYLCLLRLGLNLAS 106
237802494  27 VVNNFRGSSWKIVAIPSCILFTLIFHLPRWLIDFGVCTNLACSLSIIFWVFSLRSSASARIFPSLLLYLCLLRLGLNLAS 106
237804409  27 VVNNFRGSSWKIVAIPSCILFTLIFHLPRWLIDFGVCTNLACSLSIIFWVFSLRSSASARIFPSLLLYLCLLRLGLNLAS 106
89898387    1 -MTSKQETLWRMALIPLGILFSFLVPLPQALLDAGLCINFILSLTVVFWVFSVKSSLEAKLFPSLFLYLCLFRLGLNLAS 79 
29840190    1 MVTSKQEKLWRMALIPLGILLSFLIPLPQVLLDIGLCINFILSLTVVFWVFSLKSSRDAKLFPPLFLYLCLFRLGLNLAS 80 
16752676    1 -MSGKKDGVRGMIFVPLSILVLIFLPLPQILLDFGLCISFALSLLTVCWVFTLNSSNSAKLFPPFFLYLCLLRLGLNLAS 79 
15618278    1 -MSGKKDGVRGMIFVPLSILVLIFLPLPQILLDFGLCISFALSLLTVCWVFTLNSSNSAKLFPPFFLYLCLLRLGLNLAS 79 
62185043   81 TRLILSSGWASPMIFSLGNFFSLGSLGAGIAACCLFFLVNFLVIAKGSERVAEVRARFILEALPGKQMSLDADLVSGRAS 160
15604779  107 TRWILSSGWASPLIFALGNFFSLGSIPVALTVCLLLFLVNFLVITKGAERIAEVRARFSLEALPGKQMSLDADIAAGRIG 186
76788773  107 TRWILSSGWASPLIFALGNFFSLGSIPVALTVCLLLFLVNFLVITKGAERIAEVRARFSLEALPGKQMSLDADIAAGRIG 186
166155156 107 TRWILSSGWASPLIFALGNFFSLGSIPVALTVCLLLFLVNFLVITKGAERIAEVRARFSLEALPGKQMSLDADIAAGRIG 186
237802494 107 TRWILSSGWASPLIFALGNFFSLGSIPVALTVCLLLFLVNFLVITKGAERIAEVRARFSLEALPGKQMSLDADIAAGRIG 186
237804409 107 TRWILSSGWASPLIFALGNFFSLGSIPVALTVCLLLFLVNFLVITKGAERIAEVRARFSLEALPGKQMSLDADIAAGRIG 186
89898387   80 TRLILSSGWASPMIFSLGNFFSSGNLGAGIAACCLFFLVNFLVIAKGSERVAEVRARFILEALPGKQMSLDADLLHGRAS 159
29840190   81 TRLILSSGWASSMIFSLGNFFSSGSLGAGTVACCLFFLVNFLVIAKGSERIAEVRARFILEALPGKQMSLDADLLSGRAS 160
16752676   80 TRWIVSSGTASSLIVSLGSFFSLGSLWAATFACLLLFFVNFLMVSKGSERIAEVRSRFFLEALPAKQMALDSDLVSGRAS 159
15618278   80 TRWIVSSGTASSLIVSLGSFFSLGSLWAATFACLLLFFVNFLMVSKGSERIAEVRSRFFLEALPAKQMALDSDLVSGRAS 159
62185043  161 AMDVEKQKQDLFEESDFFSSMEGVFRFVKGDAVVSCILLIVNTIAAAYFACSVDreSASLWLTVVGDALVSQVPALMTSC 240
15604779  187 YSRASVKKSSLLEESDYFSAMEGVFRFVKGDAIMSWVLLGVNILAALFLGRATH--VGDLWLTVLGDALVSQIPALLTSC 264
76788773  187 YSRASVKKSSLLEESDYFSAMEGVFRFVKGDAIMSWVLLGVNILAALFLGRATH--VGDLWLTVLGDALVSQIPALLTSC 264
166155156 187 YSRASVKKSSLLEESDYFSAMEGVFRFVKGDAIMSWVLLGVNILAALFLGRATH--VGDLWLTVLGDALVSQIPALLTSC 264
237802494 187 YSRASVKKSSLLEESDYFSAMEGVFRFVKGDAIMSWVLLGVNILAALFLGRATH--VGDLWLTVLGDALVSQIPALLTSC 264
237804409 187 YSRASVKKSSLLEESDYFSAMEGVFRFVKGDAIMSWVLLGVNILAALFLGRATH--VGDLWLTVLGDALVSQIPALLTSC 264
89898387  160 GFDIEKQKQDLFEESDFFSAMEGVFRFVKGDAVVGCILLIVNFLSATYFSCSLDctTDSLWLTVVGDALVSQVPALLTSC 239
29840190  161 GMDVEKQKQDLFEESDFFSSMEGVFRFVKGDAIVSCILLIVNSIAATYFSYSLDgtTDSLWLTVVGDALVSQVPALLTSC 240
16752676  160 YKAVKKQKNALIEEGDFFSAMEGVFRFVKGDAIISCILLLVNVVSVTCLYYTSGyaLEQMWFTVLGDALVSQVPALLTSC 239
15618278  160 YKAVKKQKNALIEEGDFFSAMEGVFRFVKGDAIISCILLLVNVVSVTCLYYTSGyaLEQMWFTVLGDALVSQVPALLTSC 239
62185043  241 AAATLISKVGQKASLLEYMIDYYEQARVHFRTIALLFSSLLFIPGTPKAPVIVFAIALLIAYKPPKDVQGPEILSEIFQQ 320
15604779  265 AAATLIAKVGEKESLAQHLLDYYEQSRQSFLFIALILCGMACIPGAPKALILGFSVLLFLGYKNPSSGETLLFQKERVEF 344
76788773  265 AAATLIAKVGEKESLAQHLLDYYEQSRQSFLFIALILCGMACIPGAPKALILGFSVLLFLGYKNPSSGETLLFQKERVEF 344
166155156 265 AAATLIAKVGEKESLAQHLLDYYEQSRQSFLFIALILCGMACIPGAPKALILGFSVLLFLGYKNPSSGETLLFQKERVEF 344
237802494 265 AAATLIAKVGEKESLAQHLLDYYEQSRQSFLFIALILCGMACIPGAPKALILGFSVLLFLGYKNPSSGETLLFQKERVEF 344
237804409 265 AAATLIAKVGEKESLAQHLLDYYEQSRQSFLFIALILCGMACIPGAPKALILGFSVLLFLGYKNPSSGETLLFQKERVEF 344
89898387  240 AAATLISKVGQKESLLEHIMDYYEQARIHFRIIALLLSSLLFVPGVPKAPVLACVIALFISHKQKKDIQNHSLVSEGFQK 319
29840190  241 AAATLISKVGQKDSLIEHMMNYYEQARIHFRTIALLLSSLLFIPGTPKGSVALFVIALFIAYKEPKGIQDLALIPEEFQQ 320
16752676  240 AAATLISKIDKEESLLNYLFEYYKQLRQHFRVVSLLIFSLCCIPSSPKFPIVLLASLLWLAYRKEEPASEDSCIERAFSY 319
15618278  240 AAATLISKIDKEESLLNYLFEYYKQLRQHFRVVSLLIFSLCCIPSSPKFPIVLLASLLWLAYRKEEPASEDSCIERAFSY 319
62185043  321 IhlsLSTDYTGvNPHELYAQAREEIFNETGVFLHQEMKIFYRD-KPASLSCCGKHFHLEEISLSRLLPILRNLLPEAIHG 399
15604779  345 V---LPDEGVG-NPANLYKDARNQIYQELGVVFPEAIVVRHVTgSSPRLIFSGQEVALRELSCPAILESIRQLAPETISE 420
76788773  345 V---LPDEGVG-NPANLYKDARNQIYQELGVVFPEAIVVRHVTgSSPRLIFSGQEVALRELSCPAILESIRQLAPETISE 420
166155156 345 V---LPDEGVG-NPANLYKDARNQIYQELGVVFPEAIVVRYVTgSSPRLIFSGQEVALRELSCPAILESIRQLAPETISE 420
237802494 345 V---LPDEGVG-NPANLYKDARNQIYQELGVVFPEAIVVRHVTgSSPRLIFSGQEVALRELSCPAILESIRQLAPETISE 420
237804409 345 V---LPDEGVG-NPANLYKDARNQIYQELGVVFPEAIVVRHVTgSSPRLIFSGQEVALRELSCPAILESIRQLAPETISE 420
89898387  320 IylnLPVDYTGeSPREMYLLAREEIFNETGILLPQEMQIVRSE-KKASLSGGGQHFYLEEVSLTHLLPILRNLVPEAIHG 398
29840190  321 IhlsLPTNYTGeDPREIYAQVREDIFNETGVLFPQEIQIIHTE-KKASLSCGGQHFCLKEVSQLHLLLILRNLAPDAIHG 399
16752676  320 VegaCPKEQES-QFYQVYRAASEEVFEDLGVRLPVLTSLRIEE--RPWLRVFGQNVYLDEMTPEAVLPFLRNIAHEALNA 396
15618278  320 VegaCPKEQES-QFYQVYRAASEEVFEDLGVRLPVLTSLRIEE--RPWLRVFGQNVYLDEMTPEAVLPFLRNIAHEALNA 396
62185043  400 NYVKMLVRQAQNVLGISIDEIIPKKISENSLLFLIKGLVKERVSLRLFPKVLEAIALYGSPEENPEILAEKIRKYLGKHI 479
15604779  421 RFVTRLVDEFREHAFLSIEEILPLKISENSLIFLLRALVRERVSLHLFPKILEAIDVYGSQPKNSQELVECVRKYLGKQI 500
76788773  421 RFVTRLVDEFREHAFLSIEEILPLKISENSLIFLLRALVRERVSLHLFPKILEAIDVYGSQSKNSQELVECVRKYLGKQI 500
166155156 421 RFVAHLVDEFREHAFLSIEEILPLKISENSLIFLLRALVRERVSLHLFPKILEAIDVYGSQSKNSQELVECVRKYLGKQI 500
237802494 421 RFVTRLVDEFREHAFLSIEEILPLKISENSLIFLLRALVRERVSLHLFPKILEAIDVYGSQSKNSQELVECVRKYLGKQI 500
237804409 421 RFVTRLVDEFREHAFLSIEEILPLKISENSLIFLLRALVRERVSLHLFPKILEAIDVYGSQSKNSQELVECVRKYLGKQI 500
89898387  399 KIVKALIRDAQNILGISVDEIIPKKISENSLLFLLKALVKERISIRLFPKILEAIALCGSPEDSQEMLSEKIRKYLGKHI 478
29840190  400 RYIKALIRDAQNILGISIEEIIPKKISENSLLFLIKALVKERISLRLFPKILEAIALYGSHDESLETLSEKIRKYLGKHI 479
16752676  397 EVVQKYLEESERVFGIAVEDIVPKKISLSSLVVLSRLLVRERVSLKLFPKILEAVAVYQNSGDSLEILAEKVRKSLGYWI 476
15618278  397 EVVQKYLEESERVFGIAVEDIVPKKISLSSLVVLSRLLVRERVSLKLFPKILEAVAVYQNSGDSLEILAEKVRKSLGYWI 476
62185043  480 GRALWDQQNTLEIITVDSHVERMIGDLYSKSNPLMCDKVICQVQTLLnQSAGGDFRAIITGCESRFELRKMIEPYFPDLL 559
15604779  501 GLSLWNRQDVLEVITIDSLVEQFVRDSQEKVVLDLNEKVVAQVKHLL-RVGEGNFRAIVTGSETRKELKRIVDPYFPDLL 579
76788773  501 GLSLWNRQDVLEVITIDSLVEQFVRDSQEKVVLDLNEKVVAQVKHLL-RVGEGNFRAIVTGSETRKELKRIVDPYFPDLL 579
166155156 501 GLSLWNRQDVLEVITIDSLVEQFVRDSQEKVVLDLNEKVVAQVKHLL-RVGEGNFRAIVTGSETRKELKRIVDPYFPDLL 579
237802494 501 GLSLWNRQDVLEVITIDSLVEQFVRDSQEKVVLDLNEKVVAQVKHLL-RVGEGNFRAIVTGSETRKELKRIVDPYFPDLL 579
237804409 501 GLSLWNRQDVLEVITIDSLVEQFVRDSQEKVVLDLNEKVVAQVKHLL-RVGEGNFRAIVTGSETRKELKRIVDPYFPDLL 579
89898387  479 GRALWDKENTLEVITVDSHVERMIGDLYSKSNPMMCDKVVHQVRSILtQSGDGGFRAIITGCESRFELRKMIEPHFPDLL 558
29840190  480 GRALWNKENTLEVITVDSHVERMIGDLYSQSHPLMCDKVVHQVQNLLgQSGNEGFRAIITGCESRFELRKMIEPHFPDLL 559
16752676  477 GRSLWDQKQTLEVITIDFHVEELINSSYSKSNPVMQENVIRRVDSLLeRSVFKDFRAIVTSCETRFEMKKMLDPHFPDLL 556
15618278  477 GRSLWDQKQTLEVITIDFHVEELINSSYSKSNPVMQENVIRRVDSLLeRSVFKDFRAIVTSCETRFEMKKMLDPHFPDLL 556
62185043  560 VLSHNELPEEIPISLLGSVSDEVLTL 585
15604779  580 VLAHSELPEEIPITLLGAVSDEVLLS 605
76788773  580 VLAHSELPEEIPITLLGAVSDEVLLS 605
166155156 580 VLAHSELPEEIPITLLGAVSDEVLLS 605
237802494 580 VLAHSELPEEIPITLLGAVSDEVLLS 605
237804409 580 VLAHSELPEEIPITLLGAVSDEVLLS 605
89898387  559 VLSHNELPEEIPISLLGSVSDEVLAL 584
29840190  560 VLSHNELPEEIPISLLGSVSDEVLTL 585
16752676  557 VLSHDELPKEIPISFLGIVSDEVLVP 582
15618278  557 VLSHDELPKEIPISFLGIVSDEVLVP 582
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap