Conserved Protein Domain Family
PRK05906

?
PRK05906: PRK05906 
lipid A biosynthesis lauroyl acyltransferase; Provisional
Statistics
?
PSSM-Id: 168292
View PSSM: PRK05906
Aligned: 13 rows
Threshold Bit Score: 790.519
Threshold Setting Gi: 16752946
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
62185257    1 MFNTLRRAKKSFVDCCVYYLGITLIGIFKRIPHSWLHRLGKALGTLVFYTISDYKKTALTNLALAFPDKSFKERQSIAKH 80 
15604728    2 LFKRLRTGGKILVDHLVYGLGLGVLTILRLLPRSSLRLFSKGLGTALFYFISDVRKTALTNLALAFPEKSFAERYQIARQ 81 
76788722    2 LFKRLRTGGKILVDHLVYGLGLGVLTILRLLPRSSLRLFSKGLGTALFYFISDVRKTALTNLALAFPEKSFAERYQIARQ 81 
166154231   2 LFKRLRTGGKILVDHLVYGLGLGVLTILRLLPRSSLRLFSKGLGTALFYFISDFRKTALTNLALAFPEKSFAERYQIARQ 81 
166155106   2 LFKRLRTGGKILVDHLVYGLGLGVLTILRLLPRSSLRLFSKGLGTALFYFISDFRKTALTNLALAFPEKSFAERYQIARQ 81 
237802444   2 LFKRLRTGGKILVDHLVYGLGLGVLTILRLLPRSSLRLFSKGLGTALFYFISDVRKTALTNLALAFPEKSFAERYQIARQ 81 
237804359   2 LFKRLRTGGKILVDHLVYGLGLGVLTILRLLPRSSLRLFSKGLGTALFYFISDVRKTALTNLALAFPEKSFAERYQIARQ 81 
15834898    2 LFKMLRSGGKVLVDHLVYGLGLGILTILRLLPRSSLQLFGKGLGTTIFYVISDFRKTALTNLALAFPEKSFTERYQIALK 81 
89898145    1 MLKNLHRGKQSIVDFFGYYLGISLIGILKRIPHSLLSRLGKALGSIVFYTVPNYRKTALTNLALAFPDKSFTERRRIAKH 80 
29840431    1 MLKSIRRAKQTILDSFVYYLGISFISIFKHIPRSLLCCFGRVLGTIVFYTISDYRKTALTNLALAFPYKSFKERKHIAKH 80 
16752946    1 MGKKFHQIKRTILEAPLYYLVSGIIALCRHTPRSFLTGLGKGFGFLAFYIISDYRKTALTNLALAFPEKTFDERYKIARQ 80 
15618022    1 MGKKFHQIKRTILEAPLYYLVSGIIALCRHTPRSFLTGLGKGFGFLAFYIISDYRKTALTNLALAFPEKTFDERYKIARQ 80 
33241433    1 MGKKFHQIKRTILEAPLYYLVSGIIALCRHTPRSFLTGLGKGFGFLAFYIISDYRKTALTNLALAFPEKTFDERYKIARQ 80 
62185257   81 SIQHVMITVLELLAVEGLIGHLNDLISIATAEARPRGFSSDEVLTQKELQDTFSKLNENKGVILFCGHQANWELPFLYIT 160
15604728   82 SVQQMIITFVELATVDKFAKHIDEMIAIATSEDAPEGFFPEEVSSQQELDHFFSRLDRQEGAILFCGHQANWELPFLYIT 161
76788722   82 SVQQMIITFVELATVDKFAKHIDEMIAIATSEDAPEGFFPEEVSSQQELDHFFSRLDRQEGAILFCGHQANWELPFLYIT 161
166154231  82 SVQQMIITFVELATVDKFAKHIDEMIAIATSEDAPEGFFPEEVSSQQELDHFFSRLDRQEGAILFCGHQANWELPFLYIT 161
166155106  82 SVQQMIITFVELATVDKFAKHIDEMIAIATSEDAPEGFFPEEVSSQQELDHFFSRLDRQEGAILFCGHQANWELPFLYIT 161
237802444  82 SVQQMIITFVELATVDKFAKHIDEMIAIATSEDAPEGFFPEEVSSQQELDHFFSRLDRQEGAILFCGHQANWELPFLYIT 161
237804359  82 SVQQMIITFVELATVDKFAKHIDEMIAIATSEDAPEGFFPEEVSSQQELDHFFSRLDRQEGAILFCGHQANWELPFLYIT 161
15834898   82 SVQQVIITFIELATVDKFAKHIDEIITIASSEDAPEGFFPEEVSSQQELNNFFSRLDQQEGAILFCGHQANWELPFLYIT 161
89898145   81 SIQHVMITVLELLAVEGLIGNLDNLISIATAETSPEGFCHDEVLTQEELEDTFSNLSNNEGIILFCGHQANWELPFLYIT 160
29840431   81 SIQHVMITVLELLAVEGLIGNIDSLISIATEETHPEGFCGGDVLTQKELADTFSKLNENEGIILFCGHQANWELPFLFIT 160
16752946   81 SLQHLIITLLELLAIEQLVGNIDKLITIVTSSRNPKGFSSEEVISNEDLEETFKNLQEKQGLILFCGHQANWELPFLYIT 160
15618022   81 SLQHLIITLLELLAIEQLVGNIDKLITIVTSSRNPKGFSSEEVISNEDLEETFKNLQEKQGLILFCGHQANWELPFLYIT 160
33241433   81 SLQHLIITLLELLAIEQLVGNIDKLITIVTSSRNPKGFSSEEVISNEDLEETFKNLQEKQGLILFCGHQANWELPFLYIT 160
62185257  161 RDYPGLAFAKPIKNARLNKKIFSLREIFKGKIVAPKQGINSALHALQQGHVIGIVGDQALLISSYTYPLFGHEAFTTTSP 240
15604728  162 KRYPGLAFAKPVKNRRLNQKIISLRESFQGKIVPPQNAINQALRALHRGEVVGIVGDQVLLSSEYSYPLFGSQAFTTTSP 241
76788722  162 KRYPGLAFAKPVKNRRLNQKIISLRESFQGKIVPPQNAINQALRALHRGEVVGIVGDQVLLSSEYSYPLFGSQAFTTTSP 241
166154231 162 KRYPGLAFAKPVKNRRLNQKIISLRESFQGKIVPPQNAINQALRALHRGEVVGIVGDQVLLSSEYSYPLFGSQAFTTTSP 241
166155106 162 KRYPGLAFAKPVKNRRLNQKIISLRESFQGKIVPPQNAINQALRALHRGEVVGIVGDQVLLSSEYSYPLFGSQAFTTTSP 241
237802444 162 KRYPGLAFAKPVKNRRLNQKIISLRESFQGKIVPPQNAINQALRALHRGEVVGIVGDQVLLSSEYSYPLFGSQAFTTTSP 241
237804359 162 KRYPGLAFAKPVKNRRLNQKIISLRESFQGKIVPPQNAINQALRALHRGEVVGIVGDQVLLSSEYSYPLFGSQAFTTTSP 241
15834898  162 KRYPGLAFAKPVKNPRLNRKIISLRESFQGKIVPPQNAINQALRALHKGEVVGIVGDQVLLSSQYSYPLFGSQAFTTTSP 241
89898145  161 KDYPGLAFAKPIKNARLNQKIFSLREIFKGKIVSPKHGIHSAIQALQKGHVIGIVGDQALLISPYSYPLFGNEAFTTTSP 240
29840431  161 RDYPGLAFAKPIKNARLNKKIFSLRETFKGKIISPKQGIHSALQALQQGHIIGIVGDQALLISSYAYPLFGHEAFTTTSP 240
16752946  161 KNYPGIAFAKAIKNQRLSKKIFALREVFKGKIVPPKNGIQQGIEALNQGKLVGIVGDQALLMSSYTYPLFGSPAFTTTSP 240
15618022  161 KNYPGIAFAKAIKNQRLSKKIFALREVFKGKIVPPKNGIQQGIEALNQGKLVGIVGDQALLMSSYTYPLFGSPAFTTTSP 240
33241433  161 KNYPGIAFAKAIKNQRLSKKIFALREVFKGKIVPPKNGIQQGIEALNQGKLVGIVGDQALLMSSYTYPLFGSPAFTTTSP 240
62185257  241 ALLAYKTGKPVIAVSICRNTNG-YTIVPSKKLYADKSLPIKDATTSLMNKLMGFLEKGIAHQPQQWMWMHKRWKRKLSPG 319
15604728  242 ALLAYKTKKTVIAVAIYRKPNGnYLVVPSKAFHANTELSIRESTEQLMDRLMRFLEKGITCKPEQWLWLHKRWKRKLRHK 321
76788722  242 ALLAYKTKKTVIAVAIYRKPNGnYLVVPSKAFHANTELSIRESTEQLMDRLMRFLEKGITCKPEQWLWLHKRWKRKLRHK 321
166154231 242 ALLAYKTKKTVIAVAIYRKPNGnYLVVPSKAFHANTELSIRESTEQLMDRLMRFLEKGITCKPEQWLWLHKRWKRKLRHK 321
166155106 242 ALLAYKTKKTVIAVAIYRKPNGnYLVVPSKAFHANTELSIRESTEQLMDRLMRFLEKGITCKPEQWLWLHKRWKRKLRHK 321
237802444 242 ALLAYKTKKTVIAVAIYRKPNGnYLVVPSKAFHANTELSIRESTEQLMDRLMRFLEKGITCKPEQWLWLHKRWKRKLRHK 321
237804359 242 ALLAYKTKKTVIAVAIYRKPNGnYLVVPSKAFHANTELSIRESTEQLMDRLMRFLEKGITCKPEQWLWLHKRWKRKLRHK 321
15834898  242 ALLAYKTRKPVIAVAIYRQPNGnYLVVPSKAFYANTELSIRESTEQLMDKLMRFLEKGIACKPEQWLWLHKRWKRKLRHK 321
89898145  241 ALLAYKTGKPVVAVSVFRHNHG-YTIVPSKKFYADKSLPIKDSVASLMNNLMRFLEKGIAYQPQQWMWMHKRWKRKLYNK 319
29840431  241 ALLAYKTGKPVIAIAVFRHENG-YRIVPSKKFYADKSLPIKEATSSLMDNLMGFLEKGIAHKPEQWMWMHKRWKRKLFSH 319
16752946  241 ALLAYKTGFPVIAVNVSRQAKG-FEVIPSAKLYANKSLPMKESVAILMDQMMGFLEKGIASQPEQWMWIHKRWKRKISNV 319
15618022  241 ALLAYKTGFPVIAVNVSRQAKG-FEVIPSAKLYANKSLPMKESVAILMDQMMGFLEKGIASQPEQWMWIHKRWKRKISNV 319
33241433  241 ALLAYKTGFPVIAVNVSRQAKG-FEVIPSAKLYANKSLPMKESVAILMDQMMGFLEKGIASQPEQWMWIHKRWKRKISNV 319
62185257  320 LKKKYAYSHILVIVNSRDLEYFEQFLSDLARLYSGAALTLALYNPTKeKIFATNLPQYTIQEFSYLETLYTLPNSFPAVF 399
15604728  322 FKRRYAFSHILIIVKGTSLQALQRFLIEFGEFYADASLSLAIIGAAD-TVLANSFAPYSLQFFSSEEELLAAPNFFPAIV 400
76788722  322 FKRRYAFSHILIIVKGTSLQALQRFLIEFGEFYADASLSLAIIGAAD-TVLANSFAPYSLQFFSSEEELLAAPNFFPAIV 400
166154231 322 FKRRYAFSHILIIVKGTSLQALQRFLIEFGEFYADASLSLAIIGATD-TVLANSFAPYSLQFFSSEEELLAAPNFFPAIV 400
166155106 322 FKRRYAFSHILIIVKGTSLQALQRFLIEFGEFYADASLSLAIIGAAD-TVLANSFAPYSLQFFSSEEELLAAPNFFPAIV 400
237802444 322 FKRRYAFSHILIIVKGTSLQALQRFLIEFGEFYADASLSLAIIGAAD-TVLANSFAPYSLQFFSSEEELLAAPNFFPAIV 400
237804359 322 FKRRYAFSHILIIVKGTSLQALQRFLIEFGEFYADASLSLAIIGAAD-TVLANSFAPYSLQFFSSEEELLAAPNFFPAIV 400
15834898  322 FKRCYAFSHILLIVKGASLKTSQTFLTEFAEFYADASLSLAIIGTSD-FVSENSLSPYSLHFFASEEELLTIPNSFPAVV 400
89898145  320 LKKKYAYSHILVIVNASDLENSKDFLIDLAELYSGSSLTLALYNPVNeKVPYEGLSSYIIKEFPSLSLLRSLPNSFPAIF 399
29840431  320 LKKRHAYSHILVIANYATLGNFQGFLTDLADLYSGASLTLALEIPTNeKIPTDDFPQYTIKEFSSLEALHTLPNSFPAVF 399
16752946  320 IKKKYRYSHILVFVD--QVSSHFSFLKALAECFSGTTLHLTLGNADHlEELQEQFPEYSLIQLRNDQDILALPNCYPAIF 397
15618022  320 IKKKYRYSHILVFVD--QVSSHFSFLKALAECFSGTTLHLALGNADHlEELQEQFPEYSLIQLRNDQDILALPNCYPAIF 397
33241433  320 IKKKYRYSHILVFVD--QVSSHFSFLKALAECFSGTTLHLALGNADHlEELQEQFPEYSLIQLRNDQDILALPNCYPAIF 397
62185257  400 DLAELPVCLHKHFKKTGSVVLYTRKALEKNLSQPtAPLITALKKFSKNAELLKKFF 455
15604728  401 DLFGLSRKTRLHYKRTGSRKIFTRNELKDSLLQK-QSLIQSFHKLLRRVDTRSRKG 455
76788722  401 DLFGLSGKTRLHYKRTGSRKIFTRNELKDSLLQK-QSLIQSFHKLLRRVDTRSRKG 455
166154231 401 DLFGLSRKTRLHYKRTGSRKIFTRNELKDSLLQK-QSLIQSFHKLLRRVDTRSRKG 455
166155106 401 DLFGLSRKTRLHYKRTGSRKIFTRNELKDSLLQK-QSLIQSFHKLLRRVDTRSRKG 455
237802444 401 DLFGLSGKTRLHYKRTGSRKIFTRNELKDSLLQK-QSLIQSFHKLLRRVDTRSRKG 455
237804359 401 DLFGLSGKTRLHYKRTGSRKIFTRNELKDSLLQK-QSLIQSFHKLLRRVDTRSRKG 455
15834898  401 DLFGLSRKTRSHFKRTGSRKIFTNNELEASLLHG-EPLTQRFRKLLRKTQPYSN-- 453
89898145  400 DLAELPKDLHKHFKNTGSIALYTRKTLRKKLPHPnASLITALSSVSKKSQTIA--- 452
29840431  400 DLVGLPKNLHKHFKTTGSKTLYTQKTLERKLLHPqASLITALKNFSKKS------- 448
16752946  398 DLTNNLQHLYKHFRKTGSCAVYSKRFLEKSLDHP-QAPLKNSLRIFYSKNLKDKER 452
15618022  398 DLTNNLQHLYKHFRKTGSCAVYSKRFLEKSLDHP-QAPLKNSLRIFYSKNLKDKER 452
33241433  398 DLTNNLQHLYKHFRKTGSCAVYSKRFLEKSLDHP-QAPLKNSLRIFYSKNLKDKER 452
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap