Conserved Protein Domain Family
dnaE

?
PRK05898: dnaE 
DNA polymerase III subunit alpha
Statistics
?
PSSM-Id: 135648
View PSSM: PRK05898
Aligned: 5 rows
Threshold Bit Score: 1374.16
Threshold Setting Gi: 26553651
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
13357977     1 MFINLNVHSHYSLLNSTLSIDDLIKYALDNKQPYVCLTDlNNMYGCIEFYDKAKAHNLTPIIGLEFEYQ-----NATLVA 75  
26553651    12 LVLNLNTYSHYSLLSSSLSLDQIIEFAINEEKKYVCLTD-TNLYGVIEFYLKCKDKNLMPVIGLSINSQlientKYDFVL 90  
31544436     1 MFVNLNTRSYYSLLSTNLSVSEIIDFAVKNNQTHVCLTDlNVLYGAVEFYNLAKKNHLIPIIGLEIFDHs---tNSELVL 77  
170762126    1 MFINLNVHSHYSLLNSTLSIDDLIKYALDNKQPYVCLTDlNNMYGCIEFYDKAKAHNLTPIIGLEFEYQ-----NATLVA 75  
209554072    1 MFINLNVHSYYSLLNSALSIDDLIQHALDNNQPYVCLTDlNNMYGCIEFYDKAKAHNLIPIIGLEFEYQ-----NTTLVA 75  
13357977    76 YAKNYNGYLKLIKWSSWIMTSKEFEIQDDF-DDLIIVCKKGTIVFKSPNFYQTHDQNAPNAIALQSVFYANKNDKIVFLA 154 
26553651    91 FAKNKKGYLNLVKISSFLMTNNDFNYENYL-SDLFIVDKNGTFDFKTDSKVYSINPKDKNAIAFNEARYFNKNDKRVFNA 169 
31544436    78 IAKNNSGYLNLIKISSFASSNLEFDLFKYLdENLFVIVKSGDFKWDHVNCLKKKE------LAFNFVNCYDLEKKVGLNV 151 
170762126   76 YAKNYNGYLKLIKWSSWIMTSKEFEIQDDF-DDLIIVCKKGTIVFKSPNFYQTHDQNAPNAIALQSVFYANKNDKIVFLA 154 
209554072   76 YAKNYNGYLKLIKWSSWIMTNTTFIIQEDF-DDLIIVCKKGGLVFENPNFYQAQNQNASNAIALQSVFYAQENDKTVFLA 154 
13357977   155 MLAI-------KND--LKLEDFKNCCDFDnnhFLNDNLAQSFFSPIALNNLNKVLNELK-VQIHDLPIN-IPVYDKQNSI 223 
26553651   170 LQAI-------KNNrtVSIDELEEGQDLS---LLTESESVSLFNDVQIENLNNEIKEVN-LEIEFEKNN-IIKYPNESNL 237 
31544436   152 INAVsmkqagkRSK--FQIDELYNSQLVLaspFLSTEKAKKQFSQKQLDRLNDLVQQCSgWDLDNLTKNsIIKYHTPKGF 229 
170762126  155 MLAI-------KND--LKLEDFKNCCDFDnnhFLNDNLAQSFFSPIALNNLNKVLNELK-VQIHDLPIN-IPVYDKQNSI 223 
209554072  155 MLAI-------KND--LKLDDFIDCHEFDknyFLNDHEAQSLFSTIALDNLNKVLNELQ-VEIHDLPIN-IPVYDKNNLT 223 
13357977   224 ISSEILKQLCISGLKKRL--NANDGQVNKIYVQRLKYELDVINEKQFDDYFLIVYDFINFAKSNGIIVGPGRGSAAGSLV 301 
26553651   238 SDKALLHKFCMDGLNEKIfnKEIDSNSKDTYIERMEYELQIIDDMGFNDYFLVVQDFINDAKNKGILIGPGRGSAAGSLI 317 
31544436   230 DGDQYLVELCQTRFNDLL----NKRLIRASDQKRLNYELAIIKKLNFSDYFLFVYDFINHAKQQGIVIGPGRGSAAGSFI 305 
170762126  224 ISSEILKQLCISGLKKRL--NANDGQVNKIYVQRLKYELDVINEKQFDDYFLIVYDFINFAKSNGIIVGPGRGSAAGSLV 301 
209554072  224 VSSEILKQLCISGLKQRL--NAHDGQVKKVYAKRLKYELDVISEKQFDDYFLIVYDFINYAKSNGIIVGPGRGSAAGSLV 301 
13357977   302 AYCLHITDIDPIKHNLIFERFLNPTRKSMPDIDTDIMDEKRDLVIEYLFEKYGNDHVAYILTFQRLKAKMAIRDVGRILG 381 
26553651   318 AYLLGITEIDSIKYNLLFERFLNPGRITMPDIDIDIMDIRRDEVVEYLFEKYGYDHVAHIITFQKIKAKMALRDIGRILN 397 
31544436   306 SYLLNITTINPISYGLIFERFLNPQRKSMPDIDVDIMDSRREEVVDYLFNKYSKDNVAHIITFQRIKVKNAIRDVCRVLD 385 
170762126  302 AYCLHITDIDPIKHNLIFERFLNPTRKSMPDIDTDIMDEKRDLVIEYLFEKYGNDHVAYILTFQRLKAKMAIRDVGRILG 381 
209554072  302 AYCLYITDIDPIKHNLIFERFLNPTRKSMPDIDTDIMDEKRDQVIEYLFEKYGNDHVAYIVTFQRLKAKMALRDVGRILG 381 
13357977   382 IDLKVIDKICKNIKPE--------------------YDEDLDLAIKKNTiLKEMYLLHKELFEISKKLINAPRQIGTHAA 441 
26553651   398 IDLKIINSICKSITKD--------------------LEEDLANAINTKK-LQDAYKSYKDLFDLAIGIMGCPRQVGIHAA 456 
31544436   386 LKTSETDEVINFVSYDeisdweknqnatalkkvlncNECDLDQKKCKRSgAVSCYVISK-IFDLAQTIFNVPRQTGLHAA 464 
170762126  382 IDLKVIDKICKNIKPE--------------------YDEDLDLAIKKNTiLKEMYLLHKELFEISKKLINAPRQIGTHAA 441 
209554072  382 IDLKVIDKICKNIKTD--------------------YDEDIDLAIKKSAtLKEMYVLHKELFEISKKLIHAPRQIGTHAA 441 
13357977   442 GIILSDSLISNIIPIQLGINDRPLSQYSMEYLERFGLIKMDLLGLKNLTIIDNVLKMIYENQNKKIDLFNINYNDKFVFE 521 
26553651   457 GVVLSQKVLTDIVPIQTSVNGEITTQYSMDYLEDLGLIKMDLLGLTNLSTINHVCKLIKMNHGIEINLAKLNLEDQNVFL 536 
31544436   465 GVVCGNDALTQTIPLQY-LNNRSVSQFSMEYLEQFGLMKIDLLGLKTLTIIDEINSLVKLNYDRDFDINNIPLNNKNTFN 543 
170762126  442 GIILSDSLISNIIPIQLGINDRPLSQYSMEYLERFGLIKMDLLGLKNLTIIDNVLKMIYENQNKKIDLFNINYNDKFVFE 521 
209554072  442 GIILSNSSITNIIPIQLGINDRPLSQYSMEYLERFGLIKMDLLGLKNLTIIDNVLKMIYKTQNKKIDLFNIDYNDKFVFQ 521 
13357977   522 DLAKARTNGIFQLESPGMKKVLLKVKPQNIEDISIVSALFRPGPQQNIKTFVERRFKREEFSYWNEATRKILEPTYGIIV 601 
26553651   537 DLQQGHTLGIFQLESEGMTSVVKQVKPVCIEDISICSALFRPGPMQNIKPFVRRREGFEKVEYIDVKNKDILEPTHGIIV 616 
31544436   544 LLKKGYTKGVFQLESLGMQNVLKKVLPESIEDISIISALYRPGPQDNIDEYVKRRFSNTEFNYLSEDLIEILKPTHGIII 623 
170762126  522 DLAKARTNGIFQLESPGMKKVLLKVKPQNIEDISIVSALFRPGPQQNIKTFVERRFKREEFSYWNEATRKILEPTYGIIV 601 
209554072  522 DLAKAKTNGIFQLESPGMKKVLLKVKPQNIEDISIVSALFRPGPQQNIKTFVERRFKREEFSYWNEQTKKILEPTYGIII 601 
13357977   602 YQEQVIELVKTIANFDIATSDNFRRAISKKDEKILIQLKDDFINGALNNNYKQPLVNQIFEYIFSFAHYGFNHSHSLAYS 681 
26553651   617 YQEQVINLVRRIANFSLSEADMFRRIISKKKGHELDNFKKMFFENALKNDYTQDRLEQIYNYIYTFADYGFNHSHSVAYS 696 
31544436   624 YQEQVINTAMVVANFDAAQADSFRRAISKKDEALLLKDKKAFIEQAIKNRYSEQKALEIFEYLHKFADYGFNHSHSLSYA 703 
170762126  602 YQEQVIELVKTIANFDIATSDNFRRAISKKDEKILIQLKDDFINGALNNNYKQPLVNQIFEYIFSFAHYGFNHSHSLAYS 681 
209554072  602 YQEQVIELVKTIANFDIATSDNFRRAISKKDEKILMQLKDDFINGALANNYKQPLVNQIFEYIFSFAHYGFNHSHSLAYS 681 
13357977   682 YISYWLAYLKHYYTLEFLSVLLSHTSASKDKLLSYLNEAKEFNISIKGPDIQYFSNDFVIdTQKQIIRFGFKTIKGFGDE 761 
26553651   697 LIGYWMAYLKHYYPIEFMIILMTFSENDKNKIDLYVNECKRLNINIRKPDINISNKSFGL-YKKNTILFGLNSIKGIGVE 775 
31544436   704 FLAYQMAYLKANYPKEFYLILLKNNVDSKVKLTDYFIEIIERNIGIIKPNINLSDWSFSLsADHQKIILGFNMINGLGNE 783 
170762126  682 YISYWLAYLKHYYTLEFLSVLLSHTSASKDKLLSYLNEAKEFNISIKGPDIQYFSNDFVIdTQKQIIRFGFKTIKGFGDE 761 
209554072  682 YISYWLAYLKHYYPLEFLSVLLSHTSASKEKLLSYLDETKDFNISIKGPDIQHFSNDFVIdNHKQIIRFGFKTIKGFGDE 761 
13357977   762 LLKK---IKSALQKSTLSDYISYIDALKKGNVSLKNIEILIRVGTFDSFGI----------------------------- 809 
26553651   776 TSKKiieIRTNNKDKKFSDFCEAIKKLSSNKVGISTLETLINAGTFDGFKL----------------------------- 826 
31544436   784 NANK---IVQARNNKQFEGFIDCLINLAKNGITKSLFDKLVNVGVFDQFKLelskkamsalvksyfdqnvgfkndddlis 860 
170762126  762 LLKK---IKSALQKSTLSDYISYIDALKKGNVSLKNIEILIRVGTFDSFGI----------------------------- 809 
209554072  762 LLKK---IKLALENAELSDYISYIDALKKGNISLKNIEILIRIGAFDSFEI----------------------------- 809 
13357977   810 ----------NRLFLLNNLNEIFEKTGL----NGHFFDLNL------VGLDyAKDMSVNDRYLDDEIQYLGIDLNSlnya 869 
26553651   827 ----------SKKYMLENLPIIVDAASNlkddGSFLFEPRL------IDVE-GETNAEKEAFNKKEIELLGLDLNE---- 885 
31544436   861 yeekkalvrsSLFFLTKEQPELFLNLSK----DELIAENELadsllkVSFEaIKKKVYKPNIFKKEIAFLEKQIKDlktv 936 
170762126  810 ----------NRLFLLNNLNEIFEKTGL----NGHFFDLNL------VGLDyAKDMSVNDRYLDDEIQYLGIDLNSlnya 869 
209554072  810 ----------NRLFLLNNLEEIFEKTGL----NGHFFDLNL------VGLDyANDMSINERFQEDEIQYLGINLSSlnyt 869 
13357977   870 NYKTEIDYNKLKYTIKDFYEI-----NTNYETNILAQVLNIKQSKTKNGNDIFYLETLIDNKKQTLTIFQNSKYLIDEIS 944 
26553651   886 DNNNFSDKNELLYKYPDIKPItepitNGTFKSIVFIKSYEIKKTKKNTDMLSLMLVDIFNNKKKVISFSSHLISNIDSLD 965 
31544436   937 KQLKGALQKEVCSILVQIKKVel--kNKIWRFTIFDGAYEI-NAKVRDKKLSDYLTNFINQETKLIVRLDHDLF------ 1007
170762126  870 NYKTEIDYNKLKYTIKDFYEI-----NTNYETNILAQVLNIKQSKTKNGNDIFYLETLIDNKKQTLTIFQNSKYLIDEIS 944 
209554072  870 NYTNEIDYSNLKYEIESFNEI-----NTNYEVNIVAQVLNIVQSKTKKGNDIFYLDVLVENKKEKLTIFQNSKHLVDEID 944 
13357977   945 IGGIYV---FGVKLLNHFNFIVNIK 966 
26553651   966 FSKKYLgtfRGTTFGPNLTFLDEVE 990 
31544436  1008 ---------RGHDSYTILDVVDIFK 1023
170762126  945 IGGIYV---FGVKLLNHFNFIVNIK 966 
209554072  945 INGIYV---FGVKLLNHFNFIVSVK 966 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap