Conserved Protein Domain Family
PRK05884

?
PRK05884: PRK05884 
SDR family oxidoreductase
Statistics
?
PSSM-Id: 135642
View PSSM: PRK05884
Aligned: 21 rows
Threshold Bit Score: 346.412
Threshold Setting Gi: 169629518
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
108799765   1 MEVLVTGGDTDLGRTIAEGFRDDGHRVVIAGARREDLEINAKELDVDSIVFDNTDPAGVEEARSLFPHHLDTLVNVPAPQ 80 
126435406   1 MEVLVTGGDTDLGRTIAEGFRDDGHRVVIAGARREDLEINAKELDVDSIVFDNTDPAGVEEARSLFPHHLDTLVNVPAPQ 80 
119868875   1 MEVLVTGGDTDLGRTIAEGFRDDGHRVVIAGARREDLEINAKELDVDSIVFDNTDPAGVEEARSLFPHHLDTLVNVPAPQ 80 
118463407   1 MEVLVTGGDTELGRAVAEGFRDDGHKVTLVGARKSDLEIAAKELEAEAIVCDTTDPAALEQARPLFPHHLDTVVHVPAPS 80 
221230587   3 VDVLVTGGNTDLGRTIAEGFRNDGHKVTLVGPRRADLEVVAKELDVDTIVCNTTDPASLDEARGLFPRHLNTIVNVPTLG 82 
41407662    3 VEVLVTGGDTELGRAVAEGFRDDGHKVTLVGARKSDLEIAAKELEAEAIVCDTTDPAALEQARPLFPHHLDTIVHVPAPS 82 
118473731   2 AEVLVTGGDTELGRAIAQGFRDAGHNVVIAGARRDDLEVAAKELDIESIVFDNTDAASLEAVRGQFPHHLDTLVNVPAPR 81 
183982736   3 VEVLVTGGDTDLGRTVAEGFRDDGHKVTLVGARRDDLEVVAKELDADAIACDITNPASLAEVRGLFPHHLDTIVNVPAPT 82 
145223932   1 MDVLVTGCDTDLGRTIAEGFHEAGHTVLVGGRRRDELEVLAKELDTDAYVFDNTDPASVGDLHGQVPAHLDAIINVPAPT 80 
118618414   3 VEVLVTGGDTDLGRTVAEGFRDDGHKVTLVGARRDDLEVVAKELDADAIACDITNPASLAEVRGLFPHHLDTIVNVPAPT 82 
108799765  81 YPPADPRTFSLADHALAWRRALDTTVLSAVLTVQIVGDHLRSGGSIVNVIPENvviaqAREGSVDAAIKAALSDWTAGQA 160
126435406  81 YPPADPRTFSLADHALAWRRALDTTVLSAVLTVQIVGDHLRSGGSIVNVIPENvviaqAREGSVDAAIKAALSDWTAGQA 160
119868875  81 YPPADPRTFSLADHALAWRRALDTTVLSAVLTVQIVGDHLRSGGSIVNVIPENvviaqAREGSVDAAIKAALSDWTAGQA 160
118463407  81 WEAGDPRTYSIADTASAWRNALDATVLSAVLTVQTVGDHLRSGGSIISVVPEN-----PPAGSAQAAVKAALSNWTTGQA 155
221230587  83 FDTGDPRTFSLSDTANAWHNELDATVLSAVLTVQSVGDHLRSGGSIIGVLAEN-----PPAGSVDAAIKAALSSWVAGQA 157
41407662   83 WEAGDPRTYSIADTASAWRNALDATVLSAVLTVQTVGDHLRSGGSIISVVPEN-----PPAGSAQAAVKAALSNWTTGQA 157
118473731  82 WEAKDPRTYTLADLASAWRNNLDATVVSAALTVQIVGDHLRSGGSIVNVLPES-----AKEGSVEAAIKAALSDWTAGQA 156
183982736  83 WDAGDPRTYSLADTATAWRNALDTTVLSAVLTVQCVGDHLRSGGSIISVVAEN-----PPAGSVDAAIKGALSNWVAGQA 157
145223932  81 WVGGDPRAYTLTDHAAQWRGLFDANLLASVLTVQVLGDHMRSGGSIITVIPDL-----PEEGGAASAVKAAVSDWTAGLA 155
118618414  83 WDAGDPRTYSLADTATAWRNALDTTALSAVLTVQCVGDHLRSGGSIISVVAEN-----PPAGSVDAAIKGALSNWVAGQA 157
108799765 161 THFGTRGITVNAVATGKSAGPSYDGLSSTPPAVAAEIARMALFLSTPAARHITGQTMHVSRGALANFG 228
126435406 161 THFGTRGITVNAVATGKSAGPSYDGLSSTPPAVAAEIARMALFLSTPAARHITGQTMHVSRGALANFG 228
119868875 161 THFGTRGITVNAVATGKSAGPSYDGLSSTPPAVAAEIARMALFLSTPAARHITGQTMHVSRGALANFG 228
118463407 156 SVFGTRGITVNAVASGRGAQPGYDGLSRSPAPVAAEVARLALFLTSPAARHITGQTLHVSHGALAHFA 223
221230587 158 GVFGTRGITVNAIACGRSVQAGYEGLSRMPPHVATEITRLALFLTTPASRHITGQTLHVSHGALTHF- 224
41407662  158 SVFGTRGITVNAVASGRGAQPGYDGLSRSPAPVAAEVARLALFLTSPAARHITGQTLHVSHGALAHFA 225
118473731 157 DFFGTRGITINAVAAGRSAEQAYDGLTRTPPSVADEFTRLALFLSTPAARHITGQTLHVSRGALATV- 223
183982736 158 EIYGTRGITVNAVACGRSVQAGYEGLSRTPAPVAAEIARLALFLTTPAARHITGQTLHVSHGALAHFA 225
145223932 156 NHFGIRGITINAVAVGRGVEPGYDGVGATPPPASTEISRLSLFLTTPAARHITGQTLHVSHGALANFA 223
118618414 158 EIYGTRGITVNAVACGRSVQAGYEGLSRTPAPVAAEIARLALFLTTPAARHITGQTLHVSHGALAHFA 225
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap