Conserved Protein Domain Family
PRK05876

?
PRK05876: PRK05876 
short chain dehydrogenase; Provisional
Statistics
?
PSSM-Id: 135637
View PSSM: PRK05876
Aligned: 12 rows
Threshold Bit Score: 511.423
Threshold Setting Gi: 118616193
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
118465477   5 LSGFDGRAAVVTGGASGIGLATATEFARRGARLVLSDVDQPALEQAVNGLRGQGFDAHGVVCDVRHLDEMVRLADEAFRL 84 
31792039    1 MDGFPGRGAVITGGASGIGLATGTEFARRGARVVLGDVDKPGLRQAVNHLRAEGFDVHGVMCDVRHREEVTHLADEAFRL 80 
41406808    5 LSGFDGRAAVVTGGASGIGLATATEFARRGARLVLSDVDQPALEQAVNGLRGQGFDAHGVVCDVRHLDEMVRLADEAFRL 84 
15840264    4 VDGFPGRGAVITGGASGIGLATGTEFARRGARVVLGDVDKPGLRQAVNHLRAEGFDVHSVMCDVRHREEVTHLADEAFRL 83 
15607991    1 MDGFPGRGAVITGGASGIGLATGTEFARRGARVVLGDVDKPGLRQAVNHLRAEGFDVHSVMCDVRHREEVTHLADEAFRL 80 
148822059   1 MDGFPGRGAVITGGASGIGLATGTEFARRGARVVLGDVDKPGLRQAVNHLRAEGFDVHSVMCDVRHREEVTHLADEAFRL 80 
148660628   1 MDGFPGRGAVITGGASGIGLATGTEFARRGARVVLGDVDKPGLRQAVNHLRAEGFDVHSVMCDVRHREEVTHLADEAFRL 80 
253800127   1 MDGFPGRGAVITGGASGIGLATGTEFARRGARVVLGDVDKPGLRQAVNHLRAEGFDVHSVMCDVRHREEVTHLADEAFRL 80 
183984723   1 MDGFAGRGAVITGGASGIGLATATEFARRGAKVVLADIDKPGLERSVEHLRGKGFDAHGVMCDVRHLSEVNHLAAESARL 80 
118616193   1 MDGFAGSGAVITGGASGIGLATATEFARRGAKVVLADIDKPGLERSVEHLRGKGFDAHGVMCDVRHLSEVNHLAAESARL 80 
121636774   1 MDGFPGRGAVITGGASGIGLATGTEFARRGARVVLGDVDKPGLRQAVNHLRAEGFDVHGVMCDVRHREEVTHLADEAFRL 80 
224989245   1 MDGFPGRGAVITGGASGIGLATGTEFARRGARVVLGDVDKPGLRQAVNHLRAEGFDVHGVMCDVRHREEVTHLADEAFRL 80 
118465477  85 LGGVDVVFSNAGIVVAGPLAQMNHDDWRWVIDIDLWGSIHAVEAFLPRLLEQGTGGHIAFTASFAGLVPNAGLGTYGVAK 164
31792039   81 LGHFDVVFSNAGIVVGGPIVEMTHDDWRWVIDVDLWGSIHTVEAFLPRLLEQGTGGHVVFTASFAGLVPNAGLGAYGVAK 160
41406808   85 LGGVDVVFSNAGIVVAGPLAQMNHDDWRWVIDIDLWGSIHAVEAFLPRLLEQGTGGHIAFTASFAGLVPNAGLGTYGVAK 164
15840264   84 LGHVDVVFSNAGIVVGGPIVEMTHDDWRWVIDVDLWGSIHTVEAFLPRLLEQGTGGHVVFTASFAGLVPNAGLGAYGVAK 163
15607991   81 LGHVDVVFSNAGIVVGGPIVEMTHDDWRWVIDVDLWGSIHTVEAFLPRLLEQGTGGHVVFTASFAGLVPNAGLGAYGVAK 160
148822059  81 LGHVDVVFSNAGIVVGGPIVEMTHDDWRWVIDVDLWGSIHTVEAFLPRLLEQGTGGHVVFTASFAGLVPNAGLGAYGVAK 160
148660628  81 LGHVDVVFSNAGIVVGGPIVEMTHDDWRWVIDVDLWGSIHTVEAFLPRLLEQGTGGHVVFTASFAGLVPNAGLGAYGVAK 160
253800127  81 LGHVDVVFSNAGIVVGGPIVEMTHDDWRWVIDVDLWGSIHTVEAFLPRLLEQGTGGHVVFTASFAGLVPNAGLGAYGVAK 160
183984723  81 LGQIDVVFSNAGIVVAGPIADMTHDDWRWVIDIDLWGSIHTVEAFLPKLLEH--GGHIAFTASFAGLVPNAGLGAYGVAK 158
118616193  81 LGQIDVVFSNAGIVVAGPIADMTHDVWRWVIDIDLWGSIHTVEAFLPKLLEH--GGHIAFTASFAGLVPNAGLGAYGVAK 158
121636774  81 LGHVDVVFSNAGIVVGGPIVEMTHDDWRWVIDVDLWGSIHTVEAFLPRLLEQGTGGHVVFTASFAGLVPNAGLGAYGVAK 160
224989245  81 LGHVDVVFSNAGIVVGGPIVEMTHDDWRWVIDVDLWGSIHTVEAFLPRLLEQGTGGHVVFTASFAGLVPNAGLGAYGVAK 160
118465477 165 YGVVGLAETLAREVKPNGIGVSVLCPMVVETKLVSNSERIRGADYGMSATp--EGAFGPLPTQDESVSADDVARLTADAI 242
31792039  161 YGVVGLAETLAREVTADGIGVSVLCPMVVETNLVANSERIRGAACAQSST---TGSPGPLPLQDDNLGVDDIAQLTADAI 237
41406808  165 YGVVGLAETLAREVKPNGIGVSVLCPMVVETKLVSNSERIRGADYGMSATp--EGAFGPLPTQDESVSADDVARLTADAI 242
15840264  164 YGVVGLAETLAREVTADGIGVSVLCPMVVETNLVANSERIRGAACAQSST---TGSPGPLPLQDDNLGVDDIAQLTADAI 240
15607991  161 YGVVGLAETLAREVTADGIGVSVLCPMVVETNLVANSERIRGAACAQSST---TGSPGPLPLQDDNLGVDDIAQLTADAI 237
148822059 161 YGVVGLAETLAREVTADGIGVSVLCPMVVETNLVANSERIRGAACAQSST---TGSPGPLPLQDDNLGVDDIAQLTADAI 237
148660628 161 YGVVGLAETLAREVTADGIGVSVLCPMVVETNLVANSERIRGAACAQSST---TGSPGPLPLQDDNLGVDDIAQLTADAI 237
253800127 161 YGVVGLAETLAREVTADGIGVSVLCPMVVETNLVANSERIRGAACAQSST---TGSPGPLPLQDDNLGVDDIAQLTADAI 237
183984723 159 YGVVGLAETLSREMKDRGVGVTVLCPMVVETRLVSNSERIRGADYGLSSApqvTGDMGSLPAQDDSLSVDELARLTADAI 238
118616193 159 YGVVGLAETLSREMKDRGVGVTVLCPMVVETQLVSNSERIRGADYGLSSApqvTGDMGSLPAQDDSLSVDELARLTADAI 238
121636774 161 YGVVGLAETLAREVTADGIGVSVLCPMVVETNLVANSERIRGAACAQSST---TGSPGPLPLQDDNLGVDDIAQLTADAI 237
224989245 161 YGVVGLAETLAREVTADGIGVSVLCPMVVETNLVANSERIRGAACAQSST---TGSPGPLPLQDDNLGVDDIAQLTADAI 237
118465477 243 LANRLYILPHAAARESIRRRFERIDRTFDEQAAEGWTH 280
31792039  238 LANRLYVLPHAASRASIRRRFERIDRTFDEQAAEGWRH 275
41406808  243 LANRLYILPHAAARESIRRRFERIDRTFDEQAAEGWTH 280
15840264  241 LANRLYVLPHAASRASIRRRFERIDRTFDEQAAEGWRH 278
15607991  238 LANRLYVLPHAASRASIRRRFERIDRTFDEQAAEGWRH 275
148822059 238 LANRLYVLPHAASRASIRRRFERIDRTFDEQAAEGWRH 275
148660628 238 LANRLYVLPHAASRASIRRRFERIDRTFDEQAAEGWRH 275
253800127 238 LANRLYVLPHAASRASIRRRFERIDRTFDEQAAEGWRH 275
183984723 239 LANRLYVLPHEGARTSIQRRFARIDRTFDEQAAEGWRH 276
118616193 239 LANGLYVLPHEGARTSIQRRFARIDRTFDEQAAEGWRH 276
121636774 238 LANRLYVLPHAASRASIRRRFERIDRTFDEQAAEGWRH 275
224989245 238 LANRLYVLPHAASRASIRRRFERIDRTFDEQAAEGWRH 275
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap