Conserved Protein Domain Family
PRK05874

?
PRK05874: PRK05874 
L-fuculose-phosphate aldolase; Validated
Statistics
?
PSSM-Id: 102036
View PSSM: PRK05874
Aligned: 12 rows
Threshold Bit Score: 440.619
Threshold Setting Gi: 41410291
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
118463286   1 MKFVDDPEQAVLDAAKDMLRRGLVEGTAGNISARRSDGNIVITPSSVDYRDMQLDDLVLIDPAGSVLQAAQGRSPSTEMQ 80 
31791913    1 MNFVDDPESAVLAAAKDMLRRGLVEGTAGNISARRSDGNVVITPSSVDYAEMLLHDLVLVDAGGAVLHAKDGRSPSTELN 80 
41410291    1 MKFVDDPEQAVLDAAKDMLRRGLVEGTAGNISARRSDGNIVITPSSVDYRDMQLDDLVLIDPAGSVLQAAQGRSPSTEMQ 80 
15840134    1 MNFVDDPESAVLAAAKDMLRRGLVEGTAGNISARRSDGNVVITPSSVDYAEMLLHDLVLVDAGGAVLHAKDGRSPSTELN 80 
15607867    1 MNFVDAPESAVLAAAKDMLRRGLVEGTAGNISARRSDGNVVITPSSVDYAEMLLHDLVLVDAGGAVLHAKDGRSPSTELN 80 
148821932   1 MNFVDDPESAVLAAAKDMLRRGLVEGTAGNISARRSDGNVVITPSSVDYAEMLLHDLVLVDAGGAVLHAKDGRSPSTELN 80 
148660502   1 MNFVDAPESAVLAAAKDMLRRGLVEGTAGNISARRSDGNVVITPSSVDYAEMLLHDLVLVDAGGAVLHAKDGRSPSTELN 80 
253797671   1 MNFVDDPESAVLAAAKDMLRRGLVEGTAGNISARRSDGNVVITPSSVDYAEMLLHDLVLVDAGGAVLHAKDGRSPSTELN 80 
183981084   1 MKFVDNAQVAVLAAAKDMLRRGLVEGTAGNISARCADGNLVITPSSVDYADMTLDDLVQVDADGTVLHAKAGRAPSTEMH 80 
118616601   1 MKFVDNAQVAVLAAAKDMLRRGLVEGTAGNISARCADGNLVITPSSVDYADMTLDDLVQVDADGTVLHAKAGRAPSTEMH 80 
121636649   1 MNFVDDPESAVLAAAKDMLRRGLVEGTAGNISARRSDGNVVITPSSVDYAEMLLHDLVLVDAGGAVLHAKDGRSPSTELN 80 
224989121   1 MNFVDDPESAVLAAAKDMLRRGLVEGTAGNISARRSDGNVVITPSSVDYAEMLLHDLVLVDAGGAVLHAKDGRSPSTELN 80 
118463286  81 LHLACFAAFDDIGCVIHSHPVWATMFAIAHQSIPACIDEFAVYCGGDVRCAEYAASGSPDVGANAVKALQGRGAALIANH 160
31791913   81 LHLACYRAFDDIGSVIHSHPVWATMFAVAHEPIPACIDEFAIYCGGDVRCTEYAASGTPEVGRNAVRALEGRAAALIANH 160
41410291   81 LHLACFAAFDDIGCVIHSHPVWATMFAIAHQSIPACIDEFAVYCGGDVRCADYAASGTPDVGANAVKALQGRGAALIANH 160
15840134   81 LHLACYRAFDDIGSVIHSHPVWATMFAVAHEPIPACIDEFAIYCGGDVRCTEYAASGTPEVGRNAVRALEGRAAALIANH 160
15607867   81 LHLACYRAFDDIGSVIHSHPVWATMFAVAHEPIPACIDEFAIYCGGDVRCTEYAASGTPEVGRNAVRALEGRAAALIANH 160
148821932  81 LHLACYRAFDDIGSVIHSHPVWATMFAVAHEPIPACIDEFAIYCGGDVRCTEYAASGTPEVGRNAVRALEGRAAALIANH 160
148660502  81 LHLACYRAFDDIGSVIHSHPVWATMFAVAHEPIPACIDEFAIYCGGDVRCTEYAASGTPEVGRNAVRALEGRAAALIANH 160
253797671  81 LHLACYRAFDDIGSVIHSHPVWATMFAVAHEPIPACIDEFAIYCGGDVRCTEYAASGTPEVGRNAVRALEGRAAALIANH 160
183981084  81 LHLACYQAFDDIGSVIHSHPVWATMFAIAHQPIPACIDEFAVYCGGDVRCAEYAASGTPEVGRNAVAALQGRAAALIANH 160
118616601  81 LHLACYQAFDDIGSVIHSHPVWATMFAIAHQPIPACIDEFAVYCGGDVRCAEYAASGTPEVGRNAVAALQGRAAALIANH 160
121636649  81 LHLACYRAFDDIGSVIHSHPVWATMFAVAHEPIPACIDEFAIYCGGDVRCTEYAASGTPEVGRNAVRALEGRAAALIANH 160
224989121  81 LHLACYRAFDDIGSVIHSHPVWATMFAVAHEPIPACIDEFAIYCGGDVRCTEYAASGTPEVGRNAVRALEGRAAALIANH 160
118463286 161 GLVAVGPRPDKVLHITALVERTAQIVWGARALGGPVPIPEDVNRNFAAVYGYLRANP 217
31791913  161 GLVAVGPRPDQVLRVTALVERTAQIVWGARALGGPVPIPEDVCRNFTGVYGYLRANP 217
41410291  161 GLVAVGPRPDKVLHITALVERTAQIVWGARALGGPVPIPADVNRNFAAVYGYLRANP 217
15840134  161 GLVAVGPRPDQVLRVTALVERTAQIVWGARALGGPVPIPEDVCRNFTGVYGYLRANP 217
15607867  161 GLVAVGPRPDQVLRVTALVERTAQIVWGARALGGPVPIPEDVCRNFTGVYGYLRANP 217
148821932 161 GLVAVGPRPDQVLRVTALVERTAQIVWGARALGGPVPIPEDVCRNFTGVYGYLRANP 217
148660502 161 GLVAVGPRPDQVLRVTALVERTAQIVWGARALGGPVPIPEDVCRNFTGVYGYLRANP 217
253797671 161 GLVAVGPRPDQVLRVTALVERTAQIVWGARALGGPVPIPEDVCRNFTGVYGYLRANP 217
183981084 161 GLVAVGPRPDKVLHVTALVERTAQIVWGARALGGPVPIPEDVNRNFAGVYAYLRANP 217
118616601 161 GLVAVGPRPDKVLHVTALVERTAQIVWGARALGGPVPIPEDVNRNFAGVYAYLRANP 217
121636649 161 GLVAVGPRPDQVLRVTALVERTAQIVWGARALGGPVPIPEDVCRNFTGVYGYLRANP 217
224989121 161 GLVAVGPRPDQVLRVTALVERTAQIVWGARALGGPVPIPEDVCRNFTGVYGYLRANP 217
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap