Conserved Protein Domain Family
PRK05867

?
PRK05867: PRK05867 
SDR family oxidoreductase
Statistics
?
PSSM-Id: 135631
View PSSM: PRK05867
Aligned: 10 rows
Threshold Bit Score: 465.278
Threshold Setting Gi: 31793120
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
118462647   1 MLDLFDLRGRRALVTGASTGIGKQVAQAYLQAGARVAIAARDFEALQRTADELTAGGtGGVVAIRCDVTQPDEVSGMVDR 80 
31793120    3 VLDLFDLHGKRALITGASTGIGKRVALAYVEAGAQVAIAARHLDALEKLADEIGTSG-GKVVPVCCDVSQHQQVTSMLDQ 81 
41407747    3 VLDLFDLRGRRALVTGASSGIGKQVAQAYLQAGARVAIAARDFEALQRTADELTAGGtGGVVAIRCDVTQPDEVSGMVDR 82 
15609065    3 VLDLFDLHGKRALITGASTGIGKRVALAYVEAGAQVAIAARHLDALEKLADEIGTSG-GKVVPVCCDVSQHQQVTSMLDQ 81 
148823140   3 VLDLFDLHGKRALITGASTGIGKRVALAYVEAGAQVAIAARHLDALEKLADEIGTSG-GKVVPVCCDVSQHQQVTSMLDQ 81 
148661736   3 VLDLFDLHGKRALITGASTGIGKRVALAYVEAGAQVAIAARHLDALEKLADEIGTSG-GKVVPVCCDVSQHQQVTSMLDQ 81 
253799025   3 VLDLFDLHGKRALITGASTGIGKRVALAYVEAGAQVAIAARHLDALEKLADEIGTSG-GKVVPVCCDVSQHQQVTSMLDQ 81 
183982853   3 VLDLFDLSGKRALITGASTGIGKKVALAYAEAGAQVAVAARHSDALQVVADEIAGVG-GKALPIRCDVTQPDQVRGMLDQ 81 
121637833   3 VLDLFDLHGKRALITGASTGIGKRVALAYVEAGAQVAIAARHLDALEKLADEIGTSG-GKVVPVCCDVSQHQQVTSMLDQ 81 
224990317   3 VLDLFDLHGKRALITGASTGIGKRVALAYVEAGAQVAIAARHLDALEKLADEIGTSG-GKVVPVCCDVSQHQQVTSMLDQ 81 
118462647  81 MIAELGGIDIAVCNAGIISVSPMLEMPAAEFQRIQDTNVTGVFLTAQAAARAMVRQGRGGAIITTASMSGHIINVPQQVG 160
31793120   82 VTAELGGIDIAVCNAGIITVTPMLDMPLEEFQRLQNTNVTGVFLTAQAAAKAMVKQGQGGVIINTASMSGHIINVPQQVS 161
41407747   83 MIAELGGIDIAVCNAGIISVSPMLEMPAAEFQRIQDTNVTGVFLTAQAAARAMMRQGRGGAIITTASMSGHIINVPQQVG 162
15609065   82 VTAELGGIDIAVCNAGIITVTPMLDMPLEEFQRLQNTNVTGVFLTAQAAAKAMVKQGQGGVIINTASMSGHIINVPQQVS 161
148823140  82 VTAELGGIDIAVCNAGIITVTPMLDMPLEEFQRLQNTNVTGVFLTAQAAAKAMVKQGQGGVIINTASMSGHIINVPQQVS 161
148661736  82 VTAELGGIDIAVCNAGIITVTPMLDMPLEEFQRLQNTNVTGVFLTAQAAAKAMVKQGQGGVIINTASMSGHIINVPQQVS 161
253799025  82 VTAELGGIDIAVCNAGIITVTPMLDMPLEEFQRLQNTNVTGVFLTAQAAAKAMVKQGQGGVIINTASMSGHIINVPQQVS 161
183982853  82 MTGELGGIDIAVCNAGIVSVQAMLDMPLEEFQRIQDTNVTGVFLTAQAAARAMVDQGLGGTIITTASMSGHIINIPQQVS 161
121637833  82 VTAELGGIDIAVCNAGIITVTPMLDMPLEEFQRLQNTNVTGVFLTAQAAAKAMVKQGQGGVIINTASMSGHIINVPQQVS 161
224990317  82 VTAELGGIDIAVCNAGIITVTPMLDMPLEEFQRLQNTNVTGVFLTAQAAAKAMVKQGQGGVIINTASMSGHIINVPQQVS 161
118462647 161 HYCASKAAVIQLTKAMAVEFAPHDIRVNSVSPGYIRTELVEPLHEYHRQWQPKIPLGRMGRPDELAGIYLYLASAASSYM 240
31793120  162 HYCASKAAVIHLTKAMAVELAPHKIRVNSVSPGYILTELVEPYTEYQPLWEPKIPLGRLGRPEELAGLYLYLASEASSYM 241
41407747  163 HYCASKAAVIQLTKAMAVEFAPHDIRVNSVSPGYIRTELVEPLHEYHRQWEPKIPLGRMGRPDELAGIYLYLASAASSYM 242
15609065  162 HYCASKAAVIHLTKAMAVELAPHKIRVNSVSPGYILTELVEPYTEYQPLWEPKIPLGRLGRPEELAGLYLYLASEASSYM 241
148823140 162 HYCASKAAVIHLTKAMAVELAPHKIRVNSVSPGYILTELVEPYTEYQPLWEPKIPLGRLGRPEELAGLYLYLASEASSYM 241
148661736 162 HYCASKAAVIHLTKAMAVELAPHKIRVNSVSPGYILTELVEPYTEYQPLWEPKIPLGRLGRPEELAGLYLYLASEASSYM 241
253799025 162 HYCASKAAVIHLTKAMAVELAPHKIRVNSVSPGYILTELVEPYTEYQPLWEPKIPLGRLGRPEELAGLYLYLASEASSYM 241
183982853 162 HYCTSKAAVVHLTKAMAVELAPHQIRVNSVSPGYIRTELVEPLADYHALWEPKIPLGRMGRPEELTGLYLYLASAASSYM 241
121637833 162 HYCASKAAVIHLTKAMAVELAPHKIRVNSVSPGYILTELVEPYTEYQPLWEPKIPLGRLGRPEELAGLYLYLASEASSYM 241
224990317 162 HYCASKAAVIHLTKAMAVELAPHKIRVNSVSPGYILTELVEPYTEYQPLWEPKIPLGRLGRPEELAGLYLYLASEASSYM 241
118462647 241 TGSDIVIDGGYSCP 254
31793120  242 TGSDIVIDGGYTCP 255
41407747  243 TGSDIVIDGGYSCP 256
15609065  242 TGSDIVIDGGYTCP 255
148823140 242 TGSDIVIDGGYTCP 255
148661736 242 TGSDIVIDGGYTCP 255
253799025 242 TGSDIVIDGGYTCP 255
183982853 242 TGSDIVIDGGYTCP 255
121637833 242 TGSDIVIDGGYTCP 255
224990317 242 TGSDIVIDGGYTCP 255
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap