Conserved Protein Domain Family
PRK05864

?
PRK05864: PRK05864 
enoyl-CoA hydratase; Provisional
Statistics
?
PSSM-Id: 168278
View PSSM: PRK05864
Aligned: 22 rows
Threshold Bit Score: 487.033
Threshold Setting Gi: 145224253
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
108799412   1 MLCVTAEDSYVLVDRPRPQVAVVTLNRPERMNSMAFDVMVPLRDVLNELTYDNDVRAVVLTGAGRGFSSGADHKSAGSVP 80 
126435066   1 MLCVTAEDSYVLVDRPRPRVAVVTLNRPERMNSMAFDVMVPLRDVLNELTYDNDVRAVVLTGAGRGFSSGADHKSAGSVP 80 
119868525   1 MLCVTAEDSYVLVDRPRPQVAVVTLNRPERMNSMAFDVMVPLRDVLNELTYDNDVRAVVLTGAGRGFSSGADHKSAGSVP 80 
15827633   12 ELPYRSVTDLVVLDFPRPEVALITLNRPGRMNSMALDLMKSLKQVLKRITYDHSVRVVVLTGAGRGFCSGADQKFTAPVP 91 
118467382   1 ---MTDDTRFVLLDRSRPGVALVTLNRPERMNSMAFDVMVPLLELLGDLRHDNSVRVVILTGAGRGFSSGADHKSAGSVP 77 
183982291   1 -------MALVLLEHPRPDIALVTLNRPERMNSMAFDVMVPLKEVLEEVSYDNSVRVVVLTGAGRGFSSGADHKSAGAVP 73 
145224253   1 ---------------------------------MAFDVMVPLKAALDELTYDNDVRAVVLTGAGHGFSSGADHKSAGSVP 47 
118617141   1 -------MSLVLLEHPRPDIALVTLNRPERMNSIAFDVMVPLKEVLEEVSYDNSVRVVVLTGAGRGFSSGADHKSAGAVP 73 
169629821   1 -------MSFVLVDRPRPEIALVTLNRPERMNAMAFDVMLPFKQMLVDISHDNDVRAVVITGAGKGFCSGADQKSAGPIP 73 
120403725   1 MHAVTDGDGFVLVEHPRPHVALVTLNRPERMNSMAFDVMVPLKTALDEITHDNDIRVVVLTGAGAGFSSGADHKSAGSVP 80 
108799412  81 HVDGLTRPSYGLRSMEILDDVILGLRKMHQPVIAAVNGAAIGGGLCLALAADIRVAASGAYFRAAGINNGLTASELGLSY 160
126435066  81 HVDGLTRPSYGLRSMEILDDVILGLRKMHQPVIAAVNGAAIGGGLCLALAADIRVAASGAYFRAAGINNGLTASELGLSY 160
119868525  81 HVDGLTRPSYGLRSMEILDDVILGLRKMHQPVIAAVNGAAIGGGLCLALAADIRVAASGAYFRAAGINNGLTASELGLSY 160
15827633   92 QVEGLTQPVRALRAMELLEEVILALRRLHQPVIAAINGPAIGGGLCLALAADVRVASTRAYFRAAGINNGLSASELGLSY 171
118467382  78 HVDGLTRPTYALRSMEVLDNVILALRRLHQPVIAAVNGAAIGGGLCLALACDVRIAAHNAYFRAAGINNGLTASELGLSY 157
183982291  74 NVGGLTRPTYALRSMELLDEVILMLRRLHQPVIAAVNGPAIGGGLCLALAADVRVAAASAYFRAAGINNGLTASELGLSY 153
145224253  48 HVDGLTRPAFGLRSMEVLDDVILALRKLHQPVIAAVNGAAIGGGLCLALAADIRVASTSAYFRAAGINNGLTASELGLSY 127
118617141  74 NVGGLTRPTYALRSMELLDEVILMLRRLHQPVIAAVNGPAIGGGLCLALAADVRVAAASAYFRAAGINNGLTASELGLSY 153
169629821  74 HIGGLTQPTIALRSMELLDEVILTLRRMHQPVIAAINGAAIGGGLCLALACDVRVASQDAYFRAAGINNGLTASELGLSY 153
120403725  81 HVAGLTRPTFGLRSMEVLDDVILALRKLHQPVIAAVNGAAIGGGLCLALAADIRVAGSDAYFRAAGINNGLTASELGLSY 160
108799412 161 LLPRAIGSSRAFEIMLTGRDVDAEEAQRIGLVSRTVPEQDLLDVCCEMAERIAAFSRPGVELTKRTLWSGLDAGSLEAHM 240
126435066 161 LLPRAIGSSRAFEIMLTGRDVDAEEAQRIGLVSRTVPEQDLLDVCCEMAERIAAFSRPGVELTKRTLWSGLDAASLEAHM 240
119868525 161 LLPRAIGSSRAFEIMLTGRDVDAEEAQRIGLVSRTVPEQDLLDVCCEMAERIAAFSRPGVELTKRTLWSGLDAGSLEAHM 240
15827633  172 LLPRAVGSSRAFEIMLSGRDVGAEEAEQIGLVSYRVSDDRLLDTCYSIAARMATFSRSGTELTKRALWGGLDAASLDKHM 251
118467382 158 LLPRAIGTSRAFEIMLTGRDVDAAEAERIGLVSRTVPDDDLLETCFEMAQRMRGFSRPGIELTKRTLWSGLDAASLEGHM 237
183982291 154 LLPRAIGSSRAFEIMLTGRDVTAEEAERIGLVSCRVPDGQLLDTCYAIAARMAAFSRPGIELTKRTLWSGLDAASLEGHM 233
145224253 128 LLPRAIGSSRAFEIMLTGRDVDAEEAERIGLVSRRVADEDLLETCYELAERIAGFSRPGTELTKRTLWSGLDAGSLEAHM 207
118617141 154 LLPRAIGSSRAFEIMLTGRDVTAEEAERIGLVSCRVPDGQLLDTCYAITARMAAFSRPGIELTKRTLWSGLDAASLEGHM 233
169629821 154 LLPRAIGTSRASDIMLTGRDVDADEAERIGLVSRKVASESLLEECYAIGERIAGFSRPGIELTKRTIWSGLDAASLESHM 233
120403725 161 LLPRAIGASRAFEIMLTGRDVDADEAERIGLVSRRVPAEDLLPTCYDIAERIAGFSRPGTELTKRTLWTGLDAGSLEAHM 240
108799412 241 QAEGLGQLYVRLLTANFEEAVAARKEKRPAVFTDDK 276
126435066 241 QAEGLGQLYVRLLTANFEEAVAARKEKRPPVFTDDK 276
119868525 241 QAEGLGQLYVRLLTANFEEAVAARKEKRPAVFTDDK 276
15827633  252 QSESLAQLFIALHTSNFEEAAAPCTEKRPTVLVDAR 287
118467382 238 QAEGLGQLFVRLLTANFEEAVAARAEKRPPAFTDDK 273
183982291 234 QAEGLGQLFVRLLTANFEEAVAARAEKRPAVFTDDK 269
145224253 208 QAEGLGQLYIRLLTDNFEEAVAARREKRAPRFSDDR 243
118617141 234 QAEGLGQLFVRLLTANFEEAVAARAEKRPAVFTDDK 269
169629821 234 HQEGLGQLYVRLLTDNFEEATAARKEKRPAEFRDKR 269
120403725 241 QAEGLGQLYIRLLTSNFEEAVAARKEKRPPSFTDDK 276
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap