Conserved Protein Domain Family
PRK05772

?
PRK05772: PRK05772 
S-methyl-5-thioribose-1-phosphate isomerase
Statistics
?
PSSM-Id: 168237
View PSSM: PRK05772
Aligned: 16 rows
Threshold Bit Score: 608.297
Threshold Setting Gi: 145590275
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
229581078   1 MKLTVKEVKELFKPKLLPIIWKDesNTLTILDQSLLPFQKVYVDLKDVENTALAIKNMQVRGAPAIGITAGYGMVLALIN 80 
171184490   1 MEKLVEEVKRRFKPKIKPIEWRG--DRLILLDQRRLPFETRYVEARTVAEVADAIRNMVVRGAPAIGITAAFGMVISLLE 78 
119872177   1 MEKLVEELKRKFRPKIKPIEWKG--DKLVLLDQRFLPFETRYFEARTVADVAEAIRNMVVRGAPAIGITAAFGMVLSLVE 78 
145590275   1 ---------------MKPIEWRG--DKLVLLDQRMLPFETRYVEARTVEDVAAAIRDMVVRGAPAIGITAAFGMVIALSE 63 
126460776   1 MEKLVQELKEKLRPKIRPISWAG--DKLILLDQRLLPFETRYIEARTVAEVADAIREMKVRGAPAIGITAAFGMVIALIE 78 
238620820   1 MKLTVKEVKELFKPKLLPIIWKDesNTLTILDQSLLPFQKVYVDLKDVENTALAIKNMQVRGAPAIGITAGYGMVLALIN 80 
227828620   1 MKLTVKEVKELFKPKLLPIIWKDesNTLTILDQSLLPFQKVYVDLKDVENTALAIKNMQVRGAPAIGITAGYGMVLALIN 80 
229585847   1 MKLTVKEVKELFKPKLLPIIWKDesNTLTILDQSLLPFQKVYVDLKDVENTALAIKNMQVRGAPAIGITAGYGMVLALIN 80 
15921156    1 -MVTLEELKAVFKPKLKPIIWRE--DSLDLLDQSALPFQTTYITVKTPEEVAKAIKLMQVRGAPAIGITAGYGMVLALIS 77 
70606360    7 PMVKLEEIKQIFKPKLLPIIWNK--TKLTLLDQSRLPFEKIYVDVTKVEEVSDAIRTMKVRGAPAIGITAGYGMVLAIQD 84 
229581078  81 NkNVKTLDDAIRELTRAKTILDSARPTAVNLVWATSRMLTLAKNTVESgnAKAVNELIELMKVEAKKIFDEEYDAEIQMG 160
171184490  79 S-RPKTVQEALAVLASARDQLSKTRPTAVNLFWALDRMYNKAQALATS--TTSVEELEAGLEKEAVAIFEEELEAEIRMG 155
119872177  79 K-KPRTVEEALNTLTSAKETLAKTRPTAVNLFWALERMYNKATEIATS--TATVDELKSALEEEAKRIFEEELDAEIRIG 155
145590275  64 K-PIDNIDDALKTLSLARDILSKTRPTAVNLFWALDRMHNKALSLASA--TSSVRELREGLEAEAKKIFEEELEAEIRIG 140
126460776  79 K-KPRSIDEALKVLEQAKNTLAKTRPTAVNLFWALDRMYNKAVESASK--TASVNELLQDLEEEAKRIFEEELEAEIRMG 155
238620820  81 NkNVKTLDDAIRELTRAKTILDSARPTAVNLVWATSRMLTLAKNTVESgnAKAVNELIELMKVEAKKIFDEEYDAEIQMG 160
227828620  81 NkNVKTLDDAIRELTRAKTILDSARPTAVNLVWATSRMLTLAKNTVESgnAKAVNELIELMKVEAKKIFDEEYDAEIQMG 160
229585847  81 NkNVKTLDDAIRELTRAKTILDSARPTAVNLVWATSRMLTLAKNTVESgnAKAVNELIELMKVEAKKIFDEEYDAEIQMG 160
15921156   78 T-KPNTLNEAIEELVKAKQIMDQARPTAVNLSWATSRMLNFAKKKIEEgeAKSVSELIQLMKEEANRIYEEELEAELKIG 156
70606360   85 S---ISLEKAISDLTKAKKILDESRPTAVNLMWATSRMLNKAKDLVEQgnAKSVKELKELLEIEANKIFEEEYEAELKIG 161
229581078 161 LYGLEKLNDGDTVLTQCNAGGLATGTGLGTALASVKLAKALGMSVSVIAPETRPWLQGSRLTVYELMEEGIKVTLITDTA 240
171184490 156 LYGAELLEDGDTVLTICNAGGLATGTGLGTATAPIYVANMLGKRVSVVAPETRPWQQGARLTVYELVQNGVNTTLIADTA 235
119872177 156 LYGAELLENGDTVLTICNAGGLATGTGLGTATAPIYVSMMLGKQVSVVAPETRPWQQGARLTVYELIQNGVPTKLIADTA 235
145590275 141 LYGAELLEAGDTVLTICNAGGLATGTGLGTATAPIYVAKMLGKDISVIAPETRPWQQGARLTVYELVNNGIRTTLIADTA 220
126460776 156 IYGAEFLENGDTVLTICNAGGLATGTGIGTATAPIYIATALGKQVSVIAPETRPWQQGARLTVYELMQNGIRTTLIADTA 235
238620820 161 LYGLEKLNDGDTVLTQCNAGGLATGTGLGTALAPVKLAKALGMSVSVIAPETRPWLQGSRLTVYELMEEGIKVTLITDTA 240
227828620 161 LYGLEKLNDGDTVLTQCNAGGLATGTGLGTALAPVKLAKALGMSVSVIAPETRPWLQGSRLTVYELMEEGIKVTLITDTA 240
229585847 161 LYGLEKLNDGDTVLTQCNAGGLATGTGLGTALAPVKLAKALGMSVSVIAPETRPWLQGSRLTVYELMEEGIKVTLITDTA 240
15921156  157 MYGLEKISDGDTILTQCNAGGLATGTGLGTALAPVKLAHYLGMKVSVIAPETRPWLQGSRLTVYELMAEGIQVTLITDTA 236
70606360  162 LYGIEKVNDGDTILTQCNAGGLATGTGLGTALAPAKLANALGIKVSVIAPETRPWLQGSRLTVYELMEENIPVTLIADTA 241
229581078 241 VGLVMYRDMVNNVMVGADRILRDGHVFNKIGTFKEAVIAHELGIPFYALAPTSSFDLKSDVNDIKIEERDPNEVRTIRG- 319
171184490 236 VGLVMYRKLINLVMVGADRVLLDGHVYNKIGTLNEAVLAREFGIPFYVLAPTSTIDPRSRVEDVKIEERDPDEVRTARSe 315
119872177 236 VGLVMLKRLVNIVMVGADRILLDGHVYNKIGTLNEAVLAHEFGIPFYVLAPTSTIDPKSRVEDVEIEERDPDEVRTARSn 315
145590275 221 LGLVMYKRMVDIVMVGADRILLDGHVFNKIGTLNEAILAHEFGIPFYVLAPTSTIDPKSSVDSVKIEERDPDEVRTVRTs 300
126460776 236 VGLVMYKKLVNVVMVGADRILLDGHVFNKIGTLNEAVLAHEFGIPFYVLAPTSTIDTKSKVEEVKIEERDPDEVRTVRTs 315
238620820 241 VGLVMYRDMVNNVMVGADRILRDGHVFNKIGTFKEAVIAHELGIPFYALAPTSSFDLKSNVNGIKIEERDPNEVRTIRG- 319
227828620 241 VGLVMYRDMVNNVMVGADRILRDGHVFNKIGTFKEAVIAHELGIPFYALAPTSSFDLKSNVNDIKIEERDPNEVRTIRG- 319
229585847 241 VGLVMYRDMVNNVMVGADRILRDGHVFNKIGTFKEAVIAHELGIPFYALAPTSSFDLKSNVNDIKIEERDPNEVRTIRG- 319
15921156  237 VGLVIYKNMVNSVMVGADRILKDGHVFNKIGTFKEAVISHELGIPFYALAPSSSFDLKSKVDEIKIEERDPNEVRTIRG- 315
70606360  242 VGLVMFKKMVNSVMVGADRILSDGHVFNKIGTFKEAVIAHELGIPFYALAPSSTFDMISTVDQVKIEERSPDEVRSIKG- 320
229581078 320 ---IPIAPEDVNVYNPVFDVTPPKYITGIITEKGIIYPPFHENIRKIVER 366
171184490 316 qgvVYVTMRDVPVYNPVFDVTPPKYITGIITERGIATQPLHKTLRRLLKS 365
119872177 316 qgiVYVTLKEVPVYNPVFDVTPPKYITGIITEKGVATQPLYKNLRKLLNM 365
145590275 301 qgkVYVTLKDIQVYNPVFDVTPPKYITGIITEKGVATQPLSVNLRKLLKN 350
126460776 316 qgpVYVTVKDVPVFNPVFDVTPPKYVTGIITEKGVAIQPLHKNLRRLLNL 365
238620820 320 ---IPIAPEDVNVYNPVFDVTPPKYITGIITEKGIIYPPFHENIRKIVER 366
227828620 320 ---IPIAPEDVNVYNPVFDVTPPKYITGIITEKGIIYPPFHENIRKIVER 366
229585847 320 ---IPIAPEDVNVYNPVFDVTPPKYITGIITEKGIIYPPFHENIRKIVER 366
15921156  316 ---IPIVPENVKVYNPVFDVTPPKYITALITEKGVIYPPFEKNIPKIIGL 362
70606360  321 ---VYISPKEVKVYNPVFDVTPPKYVSAIITEYGIIYPPFDKNMRRMLGK 367
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap