Conserved Protein Domain Family
PRK05723

?
PRK05723: PRK05723 
flavodoxin; Provisional
Statistics
?
PSSM-Id: 168208
View PSSM: PRK05723
Aligned: 17 rows
Threshold Bit Score: 258.188
Threshold Setting Gi: 66044277
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
77457124    1 MKVAILSGSVYGTAEEVARHAQSLLNAAGFETFYNSRASLADLQAFGPEALLGVTSTTGMGELPDNLQPLYSAIRDQLPa 80 
15598631    1 MKVAILSGSVYGTAEEVARHAQKLLSAAGLEASHLPRASLDELKAFAPEAFLVVTSTTGMGELPDNLQPLYYAIRDQLP- 79 
152985249   1 MKVAILSGSVYGTAEEVARHAQKLLAAAGLDATHLPRASLDELKAFAPEAFLVVTSTTGMGELPDNLQPLYYAIRDQLP- 79 
218890366   1 MKVAILSGSVYGTAEEVARHAQKLLSAAGLEASHLPRASLDELKAFAPEAFLVVTSTTGMGELPDNLQPLYYAIRDQLP- 79 
229592536   1 MKVAILSGSVYGTAEEVARHAADLLKEAGFEAWHNPRASLADVQAFAPQAFLAVTSTTGMGELPDNLQPLYSSIRDQLPa 80 
70728337    1 MKVAILSGSVYGTAEEVARHAAKLLNAAGFEAWHNSRATLAELQAFAPQAFLAVTSTTGMGELPDNLLPLYSSIRDQLPa 80 
146308303   1 MKVAILSGSVYGTAEEVARHAERQLKAAGLDAWHKSNMSLDDLLAFAPDAFLTVTSTTGMGELPDNLMPLYCAIRDRLP- 79 
146281522   1 MKVAILSGSVYGTAEDVARHAERQLKAAGFDAWHDPRAQLQQILDFAPDALLVVTSTTGMGELPDSFIPLYTAIRDRFP- 79 
71734168    1 MKVAIVCGTVYGSAEEVARHASALLRAAGHETLVNPRLALPDVLAFEPQAILAVTSTTGMGELPDNLMPLYSELRDLLPg 80 
66044277    1 MKVAIVCGTVYGSAEEVARHAAALLRAAGHETLVNPRLMLPDLLAFEPQALLAVTSTTGMGELPDNLMPLYAALRDGLPg 80 
77457124   81 AWRGLPGAVIALGDANYGDTFCGGGEQLRELFGELGVREVQDMLRIDASESVTPETDAEPWLQQLIATLKG 151
15598631   80 AWHGLPGGVIGLGDSSYGDTFCGGGEQVRELFGELGVREVLPMLRLDASETVTPETDAEPWLAEFAAALKG 150
152985249  80 AWHGLPGGVIGLGDSSYGDTFCGGGEQVRELFGELGVREVLPMLRLDASETVTPETDAEPWLAEFVAALEG 150
218890366  80 AWHGLPGGVIGLGDSSYGDTFCGGGEQVRELFGELGVREVLPMLRLDASETVTPETDAEPWLAEFAAALKG 150
229592536  81 AWRGLPGAVIGLGDASYGDTFCGGGEQMRELFGELGVREVLPMLRLDASESVTPETDAEPWLAELVTALRA 151
70728337   81 AWRGLPGAVIGLGDSSYGDTFCGGGEQMRELFAELGVQEVLPMLRLDASESVTPETDAEPWLAELISALRG 151
146308303  80 AWHGLPAAVLALGDSSY-DTFCGGGELIRELYAELGLREVVPMLRLDSSETVTPESDAEPWLQTFAAALRG 149
146281522  80 AWSGLPGAVIALGDASYGDTFCGGGELIRELYAELGVREVVEMLRLDASETVTPESDAEPWLEAFAAALRG 150
71734168   81 QLRGLPGGVIALGDASYGDTFCAGGEQMRELFAELGVNEVQDMLRLDGSESVTPETDAEPWLAAFIKHLG- 150
66044277   81 ELRGLPGGVIALGDASYGDTFCAGGEQMRELFAELGVSEVQDMLRLDGSESVTPETDAEPWLEAFIKYLG- 150
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap