Conserved Protein Domain Family
PRK05717

?
PRK05717: PRK05717 
SDR family oxidoreductase
Statistics
?
PSSM-Id: 168204
View PSSM: PRK05717
Aligned: 17 rows
Threshold Bit Score: 439.324
Threshold Setting Gi: 152987885
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116051102   1 MIEPNLRGNGKVALVTGAARGIGLGISAWLIAEGWQVVLADNDRERGARVAEALGEHAWFVAMDVAQEGQVAMSVAEVLG 80 
15598302    1 MIEPNLRGNGKVALVTGAARGIGLGISAWLIAEGWQVVLADNDRERGARVAEALGEHAWFVAMDVAQEGQVAMSVAEVLG 80 
218890694   1 MIEPNLRGNGKVALVTGAARGIGLGISAWLIAEGWQVVLADNDRERGARVAEALGEHAWFVAMDVAQEGQVAMSVAEVLG 80 
77458131    1 MSTPKIGTHGRVALVTGAARGIGLGIAAWLISEGWQVVLTDLDRVRGSKVAKVLGENAWFIAMDVADESQVALGVAEVLG 80 
229591611   5 SMEAAAASNGRVALVTGAARGIGLGIAAWLISEGWQVVLTDLDRERGSKVSKVLGENAWFISMDVADEKQVAQGVAEVLG 84 
70729453    1 MSTPQGGGNGRVALVTGAARGIGLGIAAWLISEGWQVVLTDLDRERGSKVAKVLGESAWFITMDVADEVQVAQGVAEVLG 80 
146307731   4 WGNDSAPNNGRVALVTGAARGIGLGISAWLITEGWQVVLADIDRERGSKVARALGDNAWFVAMDVAKEDQVSVGVAEVLG 83 
71736393    1 -MKFSSVHNGRVALVTGAARGIGLGIAAWLIAEGWQVVLTDLDRARGFKVAGALGENALFIAMDVASEEQVAAGVAEVLR 79 
66044915   18 ALKFASVHNGRVALVTGAARGIGLGIAAWLIAEGWQVVLTDLDRARGSKVAGALGENALFIAMDVASEEQVAAGVAEVLR 97 
28870964    1 --------------MTGAARGIGLGIAAWLIAEGWQVVLTDLDRARGSRVASVLGENALFIGMDVASEEQVAAGVAEVLR 66 
116051102  81 QFGRLDGLVCNAAIANPRNTPLEALSLGEWTRTLAVNLTGPMLLAKYCTPYLRAHNGAIVNIASTRAHQSEPDSEAYAAS 160
15598302   81 QFGRLDGLVCNAAIANPRNTPLEALSLGEWTRTLAVNLTGPMLLAKYCTPYLRAHNGAIVNIASTRAHQSEPDSEAYAAS 160
218890694  81 QFGRLDGLVCNAAIANPRNTPLEALSLGEWTRTLAVNLTGPMLLAKYCTPYLRAHNGAIVNIASTRAHQSEPDSEAYAAS 160
77458131   81 QFGRLDALVCNAAVADPHNITLESLDLAYWNRVLAVNLGGPMLLAKHCAPYLRAHNGAIVNLASTRAAQSEPDTEAYAAS 160
229591611  85 QFGRLDALVCNAAVADPRNMTLESLDLAYWNRVLAVNLSGPMLLAKHCAPYLRAHGGAIVNLASTRARQSEPDTEAYAAS 164
70729453   81 QFGRLDALVCNAAVADPHNITLESLDLAYWNRVIAVNLGGPMLLAKHCAPYLRAHGGAIVNLASTRARQSEPDSEAYAAS 160
146307731  84 QFGRLDALVCNAGIADPHTPPLESLDLKRWNRLLAVNLTGAMLLAKHCAPYLRGHRGAIVNIASTRASQSEANCEAYAAS 163
71736393   80 QFGRLDALVCNAAIADPHNTTLESLELSHWNRVLAVNLGGPMLLAKHCAPYLRAHCGSIVNLTSTRSRQSEADTEAYAAS 159
66044915   98 QFGRLDALVCNAAIADPHNTTLESLELSHWNRVLAVNLGGPMLLAKHCAPYLRAHCGSIVNLTSTRSRQSEADTEAYAAS 177
28870964   67 QFGRLDALVCNAAVADPHNTTLESLELSHWNRVLAVNLGGPMLLAKHCAPYLRAHCGSIVNLTSTRSRQSEADTEAYAAS 146
116051102 161 KGGLLALTHALAASLGPEIRVNALSPGWIDTREAAEREAAPLTELDHDQHLVGRVGTVEDVASLVAWLLSEDAGFVTGQE 240
15598302  161 KGGLLALTHALAASLGPDIRVNALSPGWIDTREAAEREAAPLTELDHDQHLVGRVGTVEDVASLVAWLLSEDAGFVTGQE 240
218890694 161 KGGLLALTHALAASLGPDIRVNALSPGWIDTREAAEREAAPLTELDHDQHLVGRVGTVEDVASLVAWLLSEDAGFVTGQE 240
77458131  161 KGGLLALTHALAISLGPEIRVNAVSPGWIDARDPSARRAEPLTDTDHAQHPAGRVGTVEDVAAMVAWLLSKNAGFVTGQE 240
229591611 165 KGGLLALTHALAMSLGPEVRVNAVSPGWIDARDPAARRAEPLSDADHAQHPAGRVGTVEDVAAMVAWLLSRQAGFVTGQE 244
70729453  161 KGGLLALTHALAISLGPEIRVNAVSPGWIDARDPAVRRAEPLSDADHAQHPAGRVGTVEDVASMVAWLLSRNSGFVTGQE 240
146307731 164 KGGLVALTHALAVSLGPEVRVNCVSPGWIDARDPVQQRLEPLSVFDHAQHPVGRVGTVEDVAAQVAWLLSDAAGFVTGQE 243
71736393  160 KGGLMALTHALAISLGPEIRVNAVSPGWIDARDPSLRKAEPLSETDHAQHPAGRVGTVEDVAAMVAWLLSRNAGFVTGQE 239
66044915  178 KGGLMALTHALAISLGPEIRVNAVSPGWIDARDPSLRRAEPLSETDHAQHPAGRVGTVEDVAAMVAWLLSRNAGFVTGQE 257
28870964  147 KGGLMALTHALAISLGPEIRVNAVSPGWIDARDPSLRRAEPLSETDHAQHPAGRVGTVEDVAAMVAWLLSRNAGFVTGQE 226
116051102 241 FLVDGGMTRKMVYLD 255
15598302  241 FLVDGGMTRKMIYLD 255
218890694 241 FLVDGGMTRKMIYLD 255
77458131  241 FVVDGGMTKKMIYTE 255
229591611 245 FVVDGGMSKKMIYSE 259
70729453  241 FVVDGGMTKKMIYQE 255
146307731 244 FVIDGGMSRKMIYQD 258
71736393  240 FVFDGGMTRKMVYAE 254
66044915  258 FVVDGGMTRKMVYAE 272
28870964  227 FVVDGGMTRKMVYAQ 241
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap