Conserved Protein Domain Family
PRK05714

?
PRK05714: PRK05714 
2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional
Statistics
?
PSSM-Id: 168201
View PSSM: PRK05714
Aligned: 18 rows
Threshold Bit Score: 760.906
Threshold Setting Gi: 226946738
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
146284379   1 MQADLIIVGAGMVGSTLALTLEGSGLDILVLDASPLEAADFDPQGGFEPRVSALSAASQRIFERLGAWPGMSARRVSPYT 80 
116054439   1 MHADLVIVGAGMVGSALALALEGSGLEVLLVDGGSLDVAPFKPEAPYEPRVSALSEASRRILQRLHAWDGIVARRAEPYR 80 
15600414    1 MHADLVIVGAGMVGSALALALEGSGLEVLLVDGGSLDVAPFKPEAPYEPRVSALSEASRRILQRLHAWDGIVARRAEPYR 80 
152988177   6 MHADLVIVGAGMVGSALALALEGSGLEVLLVDGGSLDVAPFEPEAPYEPRVSALSEASRRILQRLHAWDGVVARRAEPYR 85 
218894323   1 MHADLVIVGAGMVGSALALALEGSGLEVLLVDGGSLDVAPFKPEAPYEPRVSALSEASRRILQRLHAWDGIVARRAEPYR 80 
77461652    3 MRADVLIVGAGMVGSALALALQGSGLEVLLLDGSPLSVKPFKGDAPFEPRVSALSAASQRILDRLGVWDGIVNRRTSPYT 82 
229593245   3 MRADVLIVGAGMVGSALALALQGSGLQVLLLDGSPLSVKPFDRDAAFEPRVSALSAASQRILERLGVWDGIVSRRASPYG 82 
70733250    1 MRADVLIVGAGMVGSALALALQGSGLEVLLLDGGSLSVKPFDDQAPFEPRVSALSAASQRILERLGAWDGIARRRSSPYC 80 
66043592    3 TRADVLIVGAGMVGSALALALQDSGLDVLVVDGGPLSVEPFDQQSSFEPRVSALSAASQRILQRLGVWEGIAARRISPYA 82 
28872333    3 TRADVLIVGAGMVGSALALALQGSGLDVLVVDGGPLSVKPFDPQSTFEPRVSALSAASQRILQRLGVWDGIASRRTSPYA 82 
146284379  81 DMHVWDGSGTGQIHFSAETVHAEVLGHIVENRVVQDALLETMQrRGGQRLLGAARLERLKRTPQGWQLTLDDGRQLNAPL 160
116054439  81 EMQVWDGSGTGRIGFSAASVHAEVLGHIVENRVVQDALLERLH-DSTTGLLANARLEQMRHSGDDWLLTLADGRQLRAPL 159
15600414   81 EMQVWDGSGTGRIGFSAASVHAEVLGHIVENRVVQDALLERLH-DSTTGLLANARLEQMRHSGDDWLLTLADGRQLRAPL 159
152988177  86 EMQVWDGSGTGQIGFSAASVHAEVLGHIVENRVVQDALLERLH-DSTTGLLANARLEQMRHSGDDWLLTLADGRQLRAPL 164
218894323  81 EMQVWDGSGTGRIGFSAASVHAEVLGHIVENRVVQDALLERLH-DSTTGLLANARLEQMRHSGDDWLLTLADGRQLRAPL 159
77461652   83 DMHVWDGSGTGQIHFSASSVHADVLGHIVENRVVQDALLERLH-DCDLGLLANARLEQMRRSGDDWLLTLADGRTLRAPL 161
229593245  83 EMQVWDGSGTGQIHFSAASVHAEVLGHIVENRVVQDALLDRLH-DCDLGLLANARLEQMRRSGDDWLLTLADGRKLRAPL 161
70733250   81 DMQVWDGSGTGLIHFSASSVHAEVLGHIVENRVVQDALLERLH-ECDIGLLANARLEQMRRSGDDWLLTLADGRQLRAPL 159
66043592   83 HMQVWDGSGTGQIHFSASSVHADVLGHIIENRVVQDALLDRLH-ASDIGLLANARLEQMRHSGDDWLLTLADGRQLRAPL 161
28872333   83 HMHVWDGSGTGQIHFSASSVHADVLGHIVENRVVQDALLDRLH-DSDIGLLANARLEQMRHSGDDWLLTLADGRLLRAPL 161
146284379 161 LVAADGANSAVRRLAGCETREWDYLHQAIVTSVRCSEPHQRTAWQRFTDDGPLAFLPLERDGDQHWCSIVWSVTELEARR 240
116054439 160 VVAADGANSAVRRLAGCATREWDYLHHAIVTSVRCENAHRATAWQRFTDDGPLAFLPLPDRGDEHWCSIVWSTTPEQAER 239
15600414  160 VVAADGANSAVRRLAGCATREWDYLHHAIVTSVRCENAHRATAWQRFTDDGPLAFLPLPDRGDEHWCSIVWSTTPEQAER 239
152988177 165 VVAADGANSAVRRLAGCATREWDYLHHAIVTSVRCEKAHRATAWQRFTDDGPLAFLPLPDRGDEHWCSIVWSTTPEQAER 244
218894323 160 VVAADGANSAVRRLAGCATREWDYLHHAIVTSVRCENAHRATAWQRFTDDGPLAFLPLPDRGDEHWCSIVWSTTPEQAER 239
77461652  162 VIAADGANSAVRRLTGVATREWDYLHHAIVTSVCSSKPHRMTAWQRFTDHGPLAFLPLERDGQQDWCSIVWSTTPSEAER 241
229593245 162 VVAADGAHSAVRRLTGTATREWDYLHNAIVTSVRSSQPHQRTAWQRFTDTGPLAFLPLVRDGQEDWCSIVWSTTPAESER 241
70733250  160 VIAADGANSAVRRLTGCTTREWDYLHHAIVTSVRSSQPHQLTAWQRFTDTGPLAFLPLVRDGQHDWCSIVWSTTPSEAER 239
66043592  162 VVAADGANSAVRRLTETPTREWDYLHHAIVTSVRTADPHRKTAWQRFTDDGPLAFLPLEREG-EHWCSIVWSVTPAEAER 240
28872333  162 VVAADGANSAVRRLTETPTREWDYLHHAIVTSVRTADSHKKTAWQRFTDDGPLAFLPLDREG-EHWCSIVWSVTPAEAER 240
146284379 241 LMALDDAAFRAALGRAFEQRLGEVEEVDPRLCIPLRQRHAKRYVQPGLALIGDAAHTIHPLAGQGVNLGLLDAAVLAEVI 320
116054439 240 LMALDEDGFRAALGEAFERRLGAILHADRRLCIPLRQRHAKRYVEPGLALVGDAAHTIHPLAGQGVNLGFLDAAVLSEVL 319
15600414  240 LMALDEDGFRAALGEAFEQRLGAILHADRRLCIPLRQRHAKRYVEPGLALVGDAAHTIHPLAGQGVNLGFLDAAVLSEVL 319
152988177 245 LMALDEDGFRAALGDAFEQRLGAILQADRRLCIPLRQRHAKRYVEPGLALVGDAAHTIHPLAGQGVNLGFLDAAVLSEVL 324
218894323 240 LMALDEDGFRAALGEAFEQRLGAILHADRRLCIPLRQRHAKRYVEPGLALVGDAAHTIHPLAGQGVNLGFLDAAVLSEVL 319
77461652  242 LMALEEADFCRELERAFEGSLGEVISADPRLCVPLRQRHAKRYVAEGLALIGDAAHTIHPLAGQGVNLGFLDAAVLAEVL 321
229593245 242 LMALDDESFCGELERAFEGRLGTVVSADPRVCVPLRQRHAKRYVAEGLALIGDAAHVIHPLAGQGVNLGFLDAAVLAEVL 321
70733250  240 LMALDDESFCAELERAFEGRLGSVISADPRLCVPLRQRHAKRYVAEGLALIGDAAHTIHPLAGQGVNLGFLDAAVLAEVL 319
66043592  241 LMVLEDDLFCRELEQAFEGRLGQVLSADSRLCVPLRQRHAKRYVAGGLALIGDAAHTIHPLAGQGVNLGFLDAAVLAEVL 320
28872333  241 LMVLEDDLFCRELEQAFEGRLGQVLSADARLCVPLRQRHAKRYVANGLALIGDAAHTIHPLAGQGVNLGFLDAAVLAQVL 320
146284379 321 EAAMARGERPEDIRVLSRFERRRMPHNLAMMAAMEGFERLFQADPLPLRWLRNTGLKAVQALPEAKALFVRQALGLSGDL 400
116054439 320 LHALERGERLADERVLSRFERRRMPHNLGMMTAMEGFERLFQADRLPLRWLRNAGLRLVDGHHEAKALFVRQALGLSGDL 399
15600414  320 LHALERGERLADERVLSRFERRRMPHNLGMMTAMEGFERLFQADRLPLRWLRNAGLRLVDGHHEAKALFVRQALGLSGDL 399
152988177 325 LHALERGERLADERVLSRFERRRMPHNLGMMTAMEGFERLFQADQLPLRWLRNAGLRLVDGHHEAKALFVRQALGLSGDL 404
218894323 320 LHALERGERLADERVLSRFERRRMPHNLGMMTAMEGFERLFQADRLPLRWLRNAGLRLVDGHHEAKALFVRQALGLSGDL 399
77461652  322 LQANERGERLADVKVLSRYERRRMPHNLALMAAMEGFERLFQADPLPLRWLRNTGLKIVEQMPEAKALFVREALGLTGDL 401
229593245 322 LAATERGERLADVKVLSRYERRRMPHNLALMAAMEGFERLFQADQLPLRWLRNAGLKMVDQMPEAKAVFVRQALGLTGDL 401
70733250  320 LQAASRGERLAEVKVLSRFERRRMPHNLALMAAMEGFERLFQADPLPMRWLRNTGLKVIDQMPEAKALFVRQALGLSGDL 399
66043592  321 THAARRGERWSDLRVLGRYERRRMPHNLALMAAMEGFERLFQADPLPLRWLRNTGLKMVNRMPEAKALFVREALGLSGDL 400
28872333  321 THAAQRGERVADLRVLGRYERRRMPHNLALMAAMEGFERLFQANPLPLRWLRNTGLKMVNQMPEAKALFVREALGLSGDL 400
146284379 401 PALARP 406
116054439 400 PALARV 405
15600414  400 PMLARV 405
152988177 405 PALARV 410
218894323 400 PSLARV 405
77461652  402 PALAKA 407
229593245 402 PGLAKP 407
70733250  400 PELARA 405
66043592  401 PELARI 406
28872333  401 PELARL 406
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap