Conserved Protein Domain Family
fliN

?
PRK05698: fliN 
flagellar motor switch protein FliN
Statistics
?
PSSM-Id: 168189
View PSSM: PRK05698
Aligned: 19 rows
Threshold Bit Score: 207.731
Threshold Setting Gi: 83647848
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
83647848    1 MAEDDDNKendlddtkSDDEALADEWAAALGeqEATDADggrEDEWAAAMaeaeSAEAKGKGADDdirAASFETFDETMP 80 
116049389   1 MADEEKVT--------TEEQALADEWAAALA--EAGDAS---QDDIDALMaq-gGATPVAEPSTP---RAPMEEFGASPK 63 
15596641    1 MADEEKVT--------TEEQALADEWAAALA--EAGDAS---QDDIDALMaq-gGATPVAEPSTP---RAPMEEFGASPK 63 
218892683   1 MADEEKVT--------TEEQALADEWAAALA--EAGDAS---QDDIDALMaq-gGATPVAEPSTP---RAPMEEFGASPK 63 
229591842   1 MATEQEITs-------AEDQALADEWAAALE--ETGDVG---QDDIDALL----AADAATAPAGK---RLPMEEFGSVPK 61 
146307836   1 MADEENTS--------PEEQALADEWAAALA--EAGDAG---QDDIDAML----AAQSSAQPAAP---RAPMEEFGSAPQ 60 
146282918  34 MADERDTTs-------PEEQALADEWAAALA--EAGDAS---QDDIDALLnqgpTAAAPAAPAAP---RAPLEDFASAPK 98 
71733965    1 MADENDMTs-------AEDQALADEWAAALG--EAGDS----QADIDALL----AADAG--NSGS---RMTMEEFGSVPK 58 
66046675    1 MADENDMTs-------AEDQALADEWAAALG--EAGDS----QADIDALL----AADAG--NSGS---RMAMEEFGSVPK 58 
28869174    1 MADENDMTs-------AEDQALADEWAAALG--EAGDS----QADIDALL----AADAG--NSGS---RMTMEEFGSVPK 58 
83647848   81 TS----APGAPDLDVILDIPVTISMEVGNTQIAIRNLLQLNQGSVIELDRLAGEPLDVLVNGTLIAHGEVVMVNEKFGIR 156
116049389  64 APti-sGLEGPNLDVILDIPVTISMEVGHTDISIRNLLQLNQGSVIELDRLAGEPLDVLVNGTLIAHGEVVVVNEKFGIR 142
15596641   64 APti-sGLEGPNLDVILDIPVTISMEVGHTDISIRNLLQLNQGSVIELDRLAGEPLDVLVNGTLIAHGEVVVVNEKFGIR 142
218892683  64 APti-sGLEGPNLDVILDIPVTISMEVGHTDISIRNLLQLNQGSVIELDRLAGEPLDVLVNGTLIAHGEVVVVNEKFGIR 142
229591842  62 NNdp-vTLDGPNLDVILDIPVSISMEVGSTDINIRNLLQLNQGSVIELDRLAGEPLDVLVNGTLIAHGEVVVVNEKFGIR 140
146307836  61 ASglpvSLDGPNLDVILDIPVSISMEVGNTDITIRNLLQLNQGSVIELDRLAGEPLDVLVNGTLIAHGEVVVVNEKFGIR 140
146282918  99 SNgmqlGLDGPNLDVILDIPVSISMEVGSTEISIRNLLQLNQGSVVELDRLAGEPLDVLVNGTLIAHGEVVVVNEKFGIR 178
71733965   59 STgp-vSLDGPNLDVILDIPVSISMEVGSTDINIRNLLQLNQGSVIELDRLAGEPLDVLVNGTLIAHGEVVVVNEKFGIR 137
66046675   59 STgp-vSLDGPNLDVILDIPVSISMEVGSTDINIRNLLQLNQGSVIELDRLAGEPLDVLVNGTLIAHGEVVVVNEKFGIR 137
28869174   59 SAgp-vTLDGPNLDVILDIPVSISMEVGSTDINIRNLLQLNQGSVIELDRLAGEPLDVLVNGTLIAHGEVVVVNEKFGIR 137
83647848  157 LTDVISPSERIKKLR 171
116049389 143 LTDVISPSERIKKLR 157
15596641  143 LTDVISPSERIKKLR 157
218892683 143 LTDVISPSERIKKLR 157
229591842 141 LTDVISPSERIKKLR 155
146307836 141 LTDVISPSERIKKLR 155
146282918 179 LTDVISPTERIKKLR 193
71733965  138 LTDVISPSERIKKLR 152
66046675  138 LTDVISPSERIKKLR 152
28869174  138 LTDVISPSERIKKLR 152
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap