Conserved Protein Domain Family
PRK05693

?
PRK05693: PRK05693 
SDR family oxidoreductase
Statistics
?
PSSM-Id: 168186
View PSSM: PRK05693
Aligned: 17 rows
Threshold Bit Score: 447.315
Threshold Setting Gi: 15599078
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116051919   3 QPVAFVTGCSSGIGRALADAFQRAGYRVWASARKEDDVRALAEAGFQAVQLDVNDAAALARLAEELEVETAGLDVLVNNA 82 
15599078    3 QPVAFVTGCSSGIGRALADAFQRAGYRVWASARKEDDVRALAEAGFQAVQLDVNDAAALARLAEELGVEAAGLDVLVNNA 82 
152988439   3 QPVALITGCSSGIGRALAEAFQAAGYRVWASARKEDDVRALAEAGFQAVQLDVNDAAALARLAGELEVEAAGLDVLVNNA 82 
218889837   3 QPVAFVTGCSSGIGRALADAFQRAGYRVWASARKEDDVRALAEAGFQAVQLDVNDAAALARLAEELEVEAAGLDVLVNNA 82 
77457172    1 MPVALITGCSSGIGRALADAFKNAGYEVWASARKVEDVATLGAAGFTAVQLDVNDNAALEQLAERINQQHGGLDVLINNA 80 
229588517   1 MPNVLITGCSSGIGRALADAFKTAGYDVWASARRAEDVAGLSAAGFNAVQLDVNDSAALQRLAEQL----GELDVLVNNA 76 
70728390    1 MPVALITGCSSGIGRALADTFKGAGFTVLATARKTEDVSALQAAGFKAVQLDVNDGPALGALGEEINQQYGGLDVLINNA 80 
71734382    1 MPIALITGCSSGIGRALADAFKATGYEVWATARKAEDVAALSAAGFIAVQLDVNDGLALEQLAAGL--EHSGLDVLINNA 78 
66044302    1 MPIALITGCSSGIGRALADAFKATGYEVWATARKADDVAALSAAGFIAVQLDVNDSLALEQLAAGL--AHSGLDVLINNA 78 
28868436    1 MPIALITGCSSGIGRALADAFKATGYEVWATARKADDVAALSAAGFIAVQLDVNDKLALEQLAAGL--EHSGLDVLINNA 78 
116051919  83 GYGAMGPLLDGGVDAMRRQFETNVFAVVGVTRALFPLLRRKSGLVVNVGSVSGVLVTPFAGAYCASKAAVHALSDALRLE 162
15599078   83 GYGAMGPLLDGGVEAMRRQFETNVFAVVGVTRALFPLLRRKSGLVVNVGSVSGVLVTPFAGAYCASKAAVHALSDALRLE 162
152988439  83 GYGAMGPLLDGGVEAMRRQFETNVFAVVGVTRALFPLLRRKSGLVVNVGSVSGVLVTPFAGAYCASKAAVHALSDALRLE 162
218889837  83 GYGAMGPLLDGGVEAMRRQFETNVFAVVGVTRALFPLLRRKSGLVVNVGSVSGVLVTPFAGAYCASKAAVHALSDALRLE 162
77457172   81 GYGAMGPLLDGGVSAMQRQFETNVFSIVGVTRALFPVLRRAKGLVVNVGSVSGVLVTPFAGAYCASKAAVHALSDALRME 160
229588517  77 GYGAMGPLLDGGTEAMQRQFETNVFSIVGVTQALFPALRRNKGLVVNIGSVSGVLVTPFAGAYCASKAAVHALSDALRME 156
70728390   81 GYGAMGPLLDGGVQAMQRQFETNVFSVVGVTRAMFPVLRRSRGLVVNIGSVSGVLVTPFAGAYCASKAAVHALSDALRME 160
71734382   79 GYGAMGPLLDGGVEALQRQFETNVFSVIGVTRALFAALRRNKGLVVNIGSVSGVLVTPFAGAYCASKAAVHALSDALRLE 158
66044302   79 GYGAMGPLLDGGVQALQRQFETNVFSVVGVTRALFPALRRNKGLVVNIGSVSGVLVTPFAGAYCASKAAVHALSDALRLE 158
28868436   79 GYGAMGPLLDGGVDALQRQFETNVFSVVGVTRALFPALRRNKGLVVNIGSVSGVLVTPFAGAYCASKAAVHALSDALRLE 158
116051919 163 LAPFGVEVLEVQPGAIASNFGASASREMDSVVDERSPWWPLRRQIQARAAASQDNPTPAEDFARQLLAAVQRRPRPPLVR 242
15599078  163 LAPFGVEVLEVQPGAIASNFGASASREMDSVVDERSPWWPLRRQIQARAAASQDNPTSAEDFARQLLAAVQRRPRPPLVR 242
152988439 163 LAPFGVEVLEVQPGAIASNFGASASREMDSVVDERSPWWPLRRQIQARSAASQDNPTPAADFARQLLAAVQRRPRPALVR 242
218889837 163 LAPFGVEVLEVQPGAIASNFGASASREMDSVVDERSPWWPLRRQIQARAAASQDNPTSAEDFARQLLAAVQRRPRPPLVR 242
77457172  161 LAPFGIRVMEVQPGAIQSSFAKNAGHEAEQLINEQSPWFPLREGIRARAKASQDKPTPASEFAAELLKAVQQSKPPRLIR 240
229588517 157 LAPFGVSVMEVQPGAINTHFAKNAGAQAELLINEQSPWWPLRDGIRARSQASQDKPTPASVFAADVLKAVQQPQAPRLLR 236
70728390  161 LAPFGIRVMEVQPGAIASSFAKNAGHEAEQLLNEQSPWWPLREGIRSRAKASQDKPTPASEFAAGLLKAVQQDNPPRLVR 240
71734382  159 LAPFGVQVMEVQPGAIASSFAKNASHEAEQLISEQSPWWPIREGIRARAKASLDNPTPATEFARDLLKAVQQTHPPRLLR 238
66044302  159 LAPFGVQVMEVQPGAIASSFAQNASHEAEQLISEQSPWWPIREGIRARARASLDNPTPVTEFARDLLRAVQHTHPPRLLR 238
28868436  159 LAPFGVQVMEVQPGAIASSFAKNASHEAEQLISEQSPWWPIRESIRARARASLDNPTPATEFARDLLKAVQHTHPPRLLR 238
116051919 243 IGNGSRALPALARWMPRGLLERLLKKRFGLDTRL 276
15599078  243 IGNGSRALPALARWLPRGLLERLLKKRFGLDTRL 276
152988439 243 IGNGSRALPALARWLPRGLLERVLKKRFGLDTRL 276
218889837 243 IGNGSRALPALARWLPRGLLERLLKKRFGLDTRL 276
77457172  241 IGNGSRALPLLATLLPKGLLESTLMKRFGLRRQL 274
229588517 237 SGNGSRALPLMAALLPKGLLEKVLKKRFGLTGSL 270
70728390  241 LGNGSRALPLLANLLPKGLLEKGLMKRFGLSARL 274
71734382  239 LGNGSRLLPLMAWLLPKALLDMGLRKRFGLNTDL 272
66044302  239 LGNGSRLLPLMAWLLPKGLLDMGLRKRFGLNADL 272
28868436  239 LGNGSSLLPLMAWLLPKGLLDMGLRKRFGLNADL 272
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap