Conserved Protein Domain Family
fliI

?
PRK05688: fliI 
flagellar protein export ATPase FliI
Statistics
?
PSSM-Id: 168181
View PSSM: PRK05688
Aligned: 22 rows
Threshold Bit Score: 811.654
Threshold Setting Gi: 120554911
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
104782818   1 MRLDRTSFGKRLEGYADAIRLPDQPVVEGRLLRMVGLTLEAEGLRAAVGSRCLVINDDSYhpvQVEAEVMGFSGDKVFLM 80 
192362186  14 PMFERQTISSRLRRYAPRHLAVTEPQAEGRITRAVGLTLEAVGLNVSVGRQCEIINSDNR---RIEAEVVGFAGDKVFLM 90 
116049033   1 MRLERTSFARRLEGYTEAVSLPAQPVVEGRLLRMVGLTLEAEGLQAAVGSRCNVINESGYhpvQVEAEVMGFSGSKVYLM 80 
15596301    1 MRLERTSFARRLEGYTEAVSLPAQPVVEGRLLRMVGLTLEAEGLQAAVGSRCNVINESGYhpvQVEAEVMGFSGSKVYLM 80 
152986739   1 MRLERTSFARRLEGYTNAVSLPAQPVVEGRLLRMVGLTLEAEGLQAAVGSRCNVINESGYhpvQVEAEVMGFSGSKVYLM 80 
218892932   1 MRLERTSFARRLEGYTEAVSLPAQPVVEGRLLRMVGLTLEAEGLQAAVGSRCNVINESGYhpvQVEAEVMGFSGSKVYLM 80 
146307844   1 MRLDRVSFARRLEGYTEAISLPSQPILEGRLLRMVGLTLEAEGLRAAIGSRCLVINGDSYhpvQVEAEVMGFSGGKIYLM 80 
146282926   8 MRLERVSFAKRFETYEAAIKLPSQPLLEGRLLRMVGLTLEAEGLRAAVGSRCLVINDDSYhptEVEAEVMGFSSGKLYLM 87 
120554911   1 ---MTSRLAERLRQLQGAISDEPAPELSGRLTRMVGLTLECVGCPMVVGDRCLIQGDSAT---SVEAEVVGFEEDKVYLM 74 
83647858    1 -----MSLVERLRNYERFVPAQARPELNGRLTRVVGLTLEAVGCPMTLGERCLIEVRGGR---MVEAEVVGFSDERVYLM 72 
104782818  81 PVGSIAGLAPGARVVPLDDSGRLPMGMSMLGRVLDGAGRALDGKGGMKAEDWVPMDGPVINPLNRDPISQPLDVGIRSIN 160
192362186  91 PVKRVEGLQPGARVIPVAGQMGMRIGPQLLGRVINGIGQPLDAKGPLAGDEYLDFNPRDINPLQRHPISETLDVGVRAIN 170
116049033  81 PVGSLAGIAPGARVVPLPDTGRLPMGMSMLGRVLDGAGRALDGKGGMRAEDWVPMDGPTINPLKRHPISEPLDVGIRSIN 160
15596301   81 PVGSLAGIAPGARVVPLPDTGRLPMGMSMLGRVLDGAGRALDGKGGMRAEDWVPMDGPTINPLKRHPISEPLDVGIRSIN 160
152986739  81 PVGSLAGIAPGARVVPLPDTGRLPMGMSMLGRVLDGAGRALDGKGGMRAEDWVPMDGPTINPLKRHPISEPLDVGIRSIN 160
218892932  81 PVGSLAGIAPGARVVPLPDTGRLPMGMSMLGRVLDGAGRALDGKGGMRAEDWVPMDGPTINPLKRHPISEPLDVGIRSIN 160
146307844  81 PVGSLAGIAPGARVVPLPDAGRLPMGMSMLGRVLDGAGRALDGKGGMKAEDWVPVDGPAINPLNRDPISQPLDVGIRTIN 160
146282926  88 PVGSLAGIAPGARVVPLVNTGRLPMGMSMLGRVLDGAGRALDGKGGMRAEDWVPMDGPVINPLKRHPISEPLDVGIRSIN 167
120554911  75 PLTAIEGLKPGARVIPLASASRVPVGPQMLGRVVNGAGDPLDGKGPLQAEARVQLTGDIINPLNRAPVRQSMDVGIRAIN 154
83647858   73 PLAAVEGLQPGAKVKPMSGVGRIGVGACLLGRVLDGAGEPLDGRGPLQAEHHVELFGAPINPLHRAPIREKLDVGIRAIN 152
104782818 161 GLLTVGRGQRLGLFAGTGVGKSVLLGMMTCFTEAEIIVVGLIGERGREVKEFIEHILGEEGLKRSVVVASPADDAPLMRL 240
192362186 171 ALITVGRGQRLGLFAGSGVGKSVLMGMMTKFTTADIVVVGLIGERGREVKEFIDHILGEEGLRRAVVVASPADDAPLMRL 250
116049033 161 GLLTVGRGQRLGLFAGTGVGKSVLLGMMTRFTRADIIVVGLIGERGREVKEFIDEILGEEGLKRSVVVASPADDAPLMRL 240
15596301  161 GLLTVGRGQRLGLFAGTGVGKSVLLGMMTRFTRADIIVVGLIGERGREVKEFIDEILGEEGLKRSVVVASPADDAPLMRL 240
152986739 161 GLLTVGRGQRLGLFAGTGVGKSVLLGMMTRFTRADIIVVGLIGERGREVKEFIDEILGEEGLKRSVVVASPADDAPLMRL 240
218892932 161 GLLTVGRGQRLGLFAGTGVGKSVLLGMMTRFTRADIIVVGLIGERGREVKEFIDEILGEEGLKRSVVVASPADDAPLMRL 240
146307844 161 GLLTVGRGQRLGLFAGTGVGKSVLLGMMTRFTEAEIIVVGLIGERGREVKEFIDEILGAEGLKRSVVVASPADDAPLMRL 240
146282926 168 GLLTVGRGQRLGLFAGTGVGKSVLLGMMTRFTEADIIVVGLIGERGREVKEFIENILGEESIKRSVVVASPADDAPLMRL 247
120554911 155 ALLTVGQGQRLGLFAGSGVGKSMLLGMMTRFTDADITVVGLIGERGREVKEFIEDILGDEGLARSVVVAAPADDSPLMRL 234
83647858  153 SLLTVGIGQRLGLFAGSGVGKSMLLGMMTRFTTADIIVVGLVGERGREVKEFIEDILGEEGLRRAVVVASPADDSPLMRL 232
104782818 241 RAAMYCTRIAEYFRDKGKNVLLLMDSLTRFAQAQREIALAIGEPPATRGYPPSVFAKLPKLVERAGNGEPGGGSITAFYT 320
192362186 251 RASLLASRIAEYYRDQGQNVLLLMDSLTRFAQAQREIALAIGEPPATKGYPPSVFAKIPQLVERAGNAAEGEGSITAFYT 330
116049033 241 RAAQYCTRIAEYFRDKGKNVLLLMDSLTRYAQAQREIALAIGEPPATKGYPPSVFAKLPKLVERAGNAEAGGGSITAFYT 320
15596301  241 RAAQYCTRIAEYFRDKGKNVLLLMDSLTRYAQAQREIALAIGEPPATKGYPPSVFAKLPKLVERAGNAEAGGGSITAFYT 320
152986739 241 RAAQYCTRIAEYFRDKGKNVLLLMDSLTRYAQAQREIALAIGEPPATKGYPPSVFAKLPKLVERAGNAEAGGGSITAFYT 320
218892932 241 RAAQYCTRIAEYFRDKGKNVLLLMDSLTRYAQAQREIALAIGEPPATKGYPPSVFAKLPKLVERAGNAEAGGGSITAFYT 320
146307844 241 RAAQYCTRIAEYFRDKGKNVLLLMDSLTRYAQAQREIALAIGEPPATKGYPPSVFAKLPRLVERAGNGEAGGGSITAFYT 320
146282926 248 RAAQYCTRIAEYFRDKGKNVLLLMDSLTRYAQAQREIALAIGEPPATKGYPPSVFAKLPSLVERAGNAERGGGSITAFYT 327
120554911 235 RAAMLTTRIAEYYRDQGKRVLLLMDSLTRYAQAQREIALAVGEPPATKGYPPSVFAKLPQLVERTGNGRPGGGSITAFYT 314
83647858  233 RAAVLTTRIAEYFRDLGKNVLLLMDSLTRYAQAQREIALAVGEPPATKGYPPSVFAKLPQLVERAGNGKPGGGSITAFYT 312
104782818 321 VLSEGDDQQDPIADSARGVLDGHFVLSRRLAEEGHYPAIDIEASISRVMPQVVDPDHLRQAQKFKQLWSRLSQSRDLISV 400
192362186 331 VLTEGDDLQDPIADSARAILDGHVVLSRRLAEEGVYPAIDVESSISRAMQNIVDDEHLKMMQRFKQLLARYQQNRDLIAI 410
116049033 321 VLSEGDDQQDPIADAARGVLDGHFVLSRRLAEEGHYPAIDIEASISRVMPQVVEAEHLRDAQRFKQLWSRYQQSRDLISV 400
15596301  321 VLSEGDDQQDPIADAARGVLDGHFVLSRRLAEEGHYPAIDIEASISRVMPQVVEAEHLRDAQRFKQLWSRYQQSRDLISV 400
152986739 321 VLSEGDDQQDPIADAARGVLDGHFVLSRRLAEEGHYPAIDIEASISRVMPQVVEPGHLRDAQRFKQLWSRYQQSRDLISV 400
218892932 321 VLSEGDDQQDPIADAARGVLDGHFVLSRRLAEEGHYPAIDIEASISRVMPQVVEAEHLRDAQRFKQLWSRYQQSRDLISV 400
146307844 321 VLSEGDDQQDPIADAARGVLDGHFVLSRRLAEEGHYPAIDIESSISRVMPQVVPPEQLKQAQRFKQLWSRYQQSRDLISV 400
146282926 328 VLSEGDDQQDPIADAARGVLDGHIVLSRRLAEEGHYPAIDIEASISRVMPQVVSAEHVRASQRFKQLWSRYQQSRDLISV 407
120554911 315 VLTEGDDQQDPIADAARAILDGHIVLSRRLAEEGHYPAIDVEASISRVMPQVTDSEHFSRAQRFKQVYSRYQQARDLISV 394
83647858  313 VLTEGDDQQDPIADAARAILDGHIVLNRRLAEEGHYPAIDVEASISRVMPQVTTPDYLQRAQRFKQLYARYQQTRDLISV 392
104782818 401 GAYVAGGDVETDLAIALQPKLVDFLRQGLDENVGMAQSREELGAIFVPPAG 451
192362186 411 GAYTQGADPETDAAIERFPHLRAFIQQGIRQPVHMAESIGNLKALLKPPAN 461
116049033 401 GAYVAGGDPETDLAIARFPVMRQFLRQGLDESESLAESRARLASLLAGGQA 451
15596301  401 GAYVAGGDPETDLAIARFPVMRQFLRQGLDESESLAESRARLASLLAGGQA 451
152986739 401 GAYVAGGDAETDLAIARFPAMRQFLRQALDESESLADSRARLASLLAGGQA 451
218892932 401 GAYVAGGDPETDLAIARFPVMRQFLRQGLDESESLAESRARLASLLAGGQA 451
146307844 401 GAYVPGGDADTDLAIARQPQMAQYLRQGLGESVDMAQSREQLAAVLGA--- 448
146282926 408 GAYVPGGDPETDMAIARQAEMVSYLRQGLDESEGLSQSAAQLAAVFTPRQA 458
120554911 395 GAYVKGSDPETDFAIQHIGNMSQFLQQGLNESAPLTEAIEQLMAVVPERRS 445
83647858  393 GAYAPGSDKETDYAIERFPHMRKFLQQSLRERATLNDSAQGLNQLFTPAPA 443
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap