Conserved Protein Domain Family
PRK05677

?
PRK05677: PRK05677 
long-chain-fatty-acid--CoA ligase; Validated
Statistics
?
PSSM-Id: 168170
View PSSM: PRK05677
Aligned: 21 rows
Threshold Bit Score: 1043.19
Threshold Setting Gi: 92113592
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116051314   1 MIENFWKDKYPAGIAAEINPDQYPNILSVLKESCQRFATKPAFTNLGKTLTYGELYKLSGDFAAYLQQHTDLKPGDRIAV 80 
15598495    1 MIENFWKDKYPAGIAAEINPDQYPNILSVLKESCQRFATKPAFTNLGKTLTYGELYKLSGDFAAYLQQHTDLKPGDRIAV 80 
152986789   1 MIENFWKDKYPAGIAAEINPDQYPNILSVLKESCQRFATKPAFTNLGKTLTYGELYKLSGDFAAYLQQHTDLKPGDRIAV 80 
218890507   1 MIENFWKDKYPAGIAAEINPDQYPNILSVLKESCQRFATKPAFTNLGKTLTYGELYKLSGDFAAYLQQHTDLKPGDRIAV 80 
77460574    1 MIEDFWKDKYPAGIAADINPDEYPNIQAVLKQSCQRFADKPAFSNLGKTLTYGELYELSGAFAAYLQQHTDLQPGDRIAV 80 
70731940    1 MIEDFWKDKYPAGIAADINPDEYPNIQAVLKQSCQRFANKPAFSNLGKTITYGELYELSGAFAAYLQQHTDLQPGDRIAL 80 
146306528   1 MTENFWKDKYPVGVAAEINPDQYPNILAVLKESCQRFADKPAFSNLGKTLTYGEIYKLSGDFAAYLQKHTDLKPGDRIAV 80 
146283295   1 MTDNFWKDKYPVGVASEINPDEYQNIQAVLRQSCERFADKPAFSNLGKTLTYGELYKLSGDFAAYLQQNTDLQPGDRIAV 80 
226945081   1 MIENFWKDKYSAGPVGEIDPDPYPNIPAVLKASCQRFADRPAFSNLGRTLSYGELYELSGTFAAFLQGLEGVQEGDRIAV 80 
120554513   2 DFEQFYQDKYPAGIPREIDLNKYKNMVDVFEQAVQKFADKPAFTAVGVTLTYRDLDTQSRNFAAWLQNKTDLKPGDRIAV 81 
116051314  81 QLPNVLQYPIVVFGAMRAGLIVVNTNPLYTARELEHQFNDSGAKAVVCLANMAHLVEGVLPKTGVKQVIVTEVGDILPPL 160
15598495   81 QLPNVLQYPIVVFGAMRAGLIVVNTNPLYTARELEHQFNDSGAKAVVCLANMAHLVEGVLPKTGVKQVIVTEVGDILPPL 160
152986789  81 QLPNVLQYPIVVFGAMRAGLIVVNTNPLYTARELEHQFNDSGAKAVVCLANMAHLVEGVLPKTGVKQVIVTEVGDILPPL 160
218890507  81 QLPNVLQYPIVVFGAMRAGLIVVNTNPLYTARELEHQFNDSGAKAVVCLANMAHLVEGVLPKTGVKQVIVTEVGDILPPL 160
77460574   81 QLPNVLQYPVAVFGAIRAGLIVVNTNPLYTAREMEHQFNDSGAKALVCLANMAHLAETVVPKTGVKHVIVTEVADLLPPI 160
70731940   81 QLPNLLQYPIAVFGAIRAGLIVVNTNPLYTAREMEHQFNDSGAKALVCLANMAHLAEAVVPKTGVRHVIVTEVADLLPPL 160
146306528  81 QLPNVLQYPIVVFGAMRAGLVVVNTNPLYTAREMEHQFNDSGAKALICLANMAHLAEQVVPKTGVKHVIVTEVGDMLPTF 160
146283295  81 QLPNLIQYPIVVFGAMRAGLIVVNTNPLYTAREMEHQFNDAGAKALVCLANMAHLAEEVLPKTGIKHVVITEVADMLPPL 160
226945081  81 QLPNLLQYPVAVFGALRAGLVVVNTNPLYTAREMLHQFNDSGAKVLVCLANKAHLVEEVLPRTGIRHVLVTEVGDLLPPF 160
120554513  82 QMPNVTQYPVVVFGAMRAGLIVVNTNPLYTIREMEHQFNDSGAKALVVLANMADNAEKVLPHTGIEHVIVTEIADMHSPI 161
116051314 161 KRFIVNFVVKHIKKMVPAYSLPQATNLTDALARGAGKSFQEAAPQADDVAVLQYTGGTTGVAKGAMLTHRNLVANMLQCK 240
15598495  161 KRFIVNFVVKHIKKMVPAYSLPQATKLTDALARGAGKSFQEAAPQADDVAVLQYTGGTTGVAKGAMLTHRNLVANMLQCK 240
152986789 161 KRFIVNFVVKHIKKMVPAYSLPQATKLTDALARGAGKSFQEAAPKADDVAVLQYTGGTTGVAKGAMLTHRNLVANMLQCK 240
218890507 161 KRFIVNFVVKHIKKMVPAYSLPQATKLTDALARGAGKSFQEAAPQADDVAVLQYTGGTTGVAKGAMLTHRNLVANMLQCK 240
77460574  161 KRLLINSVIKYVKKMVPAYHLPKAVKFNDVLSKGQGQPVAEANPDSGDVAVLQYTGGTTGVAKGAMLTHRNLVANMLQCK 240
70731940  161 KRLLINSVVKYVKKMVPAYHLPQAVKFNDVLRKGHGQPVQEANPASSDVAVLQYTGGTTGVAKGAMLTHRNLVANMLQCK 240
146306528 161 KRLLVNAVIKHVKKMVPSYHLPQAVKLNDALAKGRGQSFNEANPSNADIAVLQYTGGTTGVAKGAMLTHRNLVANMLQVK 240
146283295 161 KRMLINAVVKHVKKMVPAYSLPKAVKLNDALALGRGKAVREASPKSEDVAVLQYTGGTTGVAKGAMLTHRNIVANMLQCK 240
226945081 161 RRVLVNAVVRHLKRMVPAYHLPQALKFTEALSRGRERTLREVAAAPDDIAVLQYTGGTTGTPKGAMLTQRNLVANMLQCR 240
120554513 162 KRTLMNAAVKHLKKMVPAFNIPGAHKLPAVLSAGAREKFTPVDIKLDDLAVLQYTGGTTGVAKGAMLTHANLVANLTQVR 241
116051314 241 ALMGANLNEGCEILIAPLPLYHIYAFTFHCMAMMLTGNHNILITNPRDLPSMLKDLGQWKFTGFVGLNTLFVALCNNETF 320
15598495  241 ALMGANLNEGCEILIAPLPLYHIYAFTFHCMAMMLTGNHNILITNPRDLPSMLKDLGQWKFTGFVGLNTLFVALCNNETF 320
152986789 241 ALMGANLNEGCEILIAPLPLYHIYAFTFHCMAMMLTGNHNILITNPRDLPSMLKDLGQWKFTGFVGLNTLFVALCNNETF 320
218890507 241 ALMGANLNEGCEILIAPLPLYHIYAFTFHCMAMMLTGNHNILITNPRDLPSMLKDLGQWKFTGFVGLNTLFVALCNNETF 320
77460574  241 ALMGSNLNEGCEILITPLPLYHIYAFTFHCMAMMLIGNHNILISNPRDLPAMVKELSKWKFSGFVGLNTLFVALCNNEGF 320
70731940  241 ALMGSNLNEGCEILITPLPLYHIYAFTFHCMAIMLMGNHNILISNPRDLPAMVKELSKWKFSGFVGLNTLFVALCNSEAF 320
146306528 241 ELMGANLDEGCEVLIAPLPLYHIYAFTFHCMAMMLIGGHNILLTNPRDLPAVVKDLAKYRFTGFVGLNTLFVALCNNEEF 320
146283295 241 ALMGANLNDGSEVLIAPLPLYHIYAFTFHCMAMMLSGNHNILISNPRDLPAMIKDLGKYRFSGFVGLNTLFVALCNSEDF 320
226945081 241 ALVAGVLGEGCETLVAPLPLYHIYAFTLHCMAMMLIGNHNLLITDPRDLPGMVRVLRKWRFSGFVGLNTLFAALCHDEGF 320
120554513 242 PMLEDQVEEGKEVVIAPLPLYHIYSFTLNCGIMLEAGAHNVLIPNPRDIPGFVKELQKQKFSAFIGLNTLFVALCNNEDF 321
116051314 321 RKLDFSALKLTLSGGMALQLATAERWKEVTGCAICEGYGMTETAPVVSVNPFQNIQVGTIGIPVPSTLCKVIGDDGQEVP 400
15598495  321 RKLDFSALKLTLSGGMALQLATAERWKEVTGCAICEGYGMTETAPVVSVNPFQNIQVGTIGIPVPSTLCKVIGDDGQEVP 400
152986789 321 RKLDFSALKLTLSGGMALQLATAERWKEVTGCAICEGYGMTETAPVVSVNPFQNIQVGTIGIPVPSTLCKVIGDDGQEVP 400
218890507 321 RKLDFSALKLTLSGGMALQLATAERWKEVTGCAICEGYGMTETAPVVSVNPFQNIQVGTIGIPVPSTLCKVIGDDGQEVP 400
77460574  321 RKLDFSALKVTLSGGMALQLAAAERWKAVTGCPICEGYGMTETSPVATVNPIQNIQIGTIGIPVPSTLCKVIDDAGVEQP 400
70731940  321 RKLDFSALKVTLSGGMALQLAAAERWKEVTNCPICEGYGMTETSPVATVNPIQNIQIGTIGIPVPSTLCRVVDDAGEELP 400
146306528 321 RKLDFSALKLTVSGGMALQLATAERWKEVTGCAICEGFGMTETSPVATVNPFSAIQLGTIGIPVPSTLCKIINDDGQELA 400
146283295 321 RKLDFSALKVTLSGGMALQLATAERWKQVTGCPICEGYGLTETSPVASVNPIEHIQLGSIGIPVPSTQFKVINDDGQELA 400
226945081 321 RCLDFSALKLTLSGGMALQQATAECWKGLTGCEVLEGYGLTEASPVVSGNPYGHIRPGTIGMPLASTLCKVVDEQGREVP 400
120554513 322 QDLDFSGLKLTASGGMALTSDTAKMWQRVTGCEISEGYGMTETSPVVTFNPRSAIQIGTIGLPIPSTVVKTIDDDGNETP 401
116051314 401 LGERGELCVKGPQVMKGYWQRQEATDEILDADGWLKTGDIAIIQEDGYMRIVDRKKDMILVSGFNVYPNELEDVLATLPG 480
15598495  401 LGERGELCVKGPQVMKGYWQRQEATDEILDADGWLKTGDIAIIQEDGYMRIVDRKKDMILVSGFNVYPNELEDVLATLPG 480
152986789 401 LGERGELCVKGPQVMKGYWQRQEATDEILDADGWLKTGDIAIIQEDGYMRIVDRKKDMILVSGFNVYPNELEDVLATLPG 480
218890507 401 LGERGELCVKGPQVMKGYWQRQEATDEILDADGWLKTGDIAIIQEDGYMRIVDRKKDMILVSGFNVYPNELEDVLATLPG 480
77460574  401 LGEIGELCVKGPQVMKGYWQRQEATDEMLDSEGWLKTGDIALIQPDGYMRIVDRKKDMILVSGFNVYPNELEDVLAALPG 480
70731940  401 LGEVGELCVKGPQVMKGYWQRQDATDEVLNSEGWLKTGDIALIQPNGYIRIVDRKKDMILVSGFNVYPNELEDVLASLPG 480
146306528 401 IGEIGELCVKGPQVMKGYWQRQEATDEILDADGWLKTGDIGLIQEDGYLRIVDRKKDMILVSGFNVYPNELEDVLATLPG 480
146283295 401 QGEIGELCIKGPQVMKGYWQRPEATDEVIDADGWFKTGDIGVIQEDGYIRIVDRKKDMILVSGFNVYPNELEDVLASLPG 480
226945081 401 SGSSGELWVKGPQVMKGYWQNPGATAEVLDADGWLRTGDIAVIEPDGYLRIVDRKKDMILVSGFNVYPNELEEVLAALPG 480
120554513 402 VGEPGELCVKGPQVMRGYWQRPDDTQKSFTDDGFLKTGDVALIQEDGYIRIVDRKKDMIIVSGFNVFPNEIEDVVTTHPK 481
116051314 481 VLQCAAIGIPDEKSGESIKVFVVVKPGATLTKEQVMQHMHDNLTGYKRPKAVEFRDSLPTTNVGKILRRELRDEELKKAG 560
15598495  481 VLQCAAIGIPDEKSGESIKVFVVVKPGATLTKEQVMQHMHDNLTGYKRPKAVEFRDSLPTTNVGKILRRELRDEELKKAG 560
152986789 481 VLQCAAIGIPDEKSGESIKVFVVVKPGATLTKEQVMQHMHDNLTGYKRPKAVEFRDSLPTTNVGKILRRELRDEELKKAG 560
218890507 481 VLQCAAIGIPDEKSGESIKVFVVVKPGATLTKEQVMQHMHDNLTGYKRPKAVEFRDSLPTTNVGKILRRELRDEELKKAG 560
77460574  481 VLQCAAIGVPDEKSGEAIKIFIVAKPGVTLTKEQVMEHMRANVTGYKVPRSVEFRDALPTTNVGKILRRELRDEELKKIK 560
70731940  481 VLQCAAIGVPDEKSGETIKIFIVVKPGVTLTKEQVMAHMRANVTGYKVPKAVEFRDALPTTNVGKILRRELRDEELKKLG 560
146306528 481 VLQCAAIGVPDEKSGEAIKVFVVVKPGESVTKEQVMEHMRANLTGYKVPKAVEFRDVLPTTNVGKILRRELRDEELKKLG 560
146283295 481 VLQCAAIGVPDEKSGEAIKLFVVVKPGESLTKEQVMQHMHDNLTGYKRPRYVEFRESLPTTNVGKILRRELRDEELRKLG 560
226945081 481 VLQCAAIGVPDERTGEAIKLFVVPRPGSGLTEERVLRHMHDNLTGYKRPKHVEFRDRLPTSNVGKILRRELRDGAPGQAA 560
120554513 482 VVECAAVGIPDAKSGEAVKVYVV-PTKEGVTANEIKEFCRERLTAYKVPKHFEFRDELPKSNVGKILRRELRDEANAK-- 558
116051314 561 QK 562
15598495  561 QK 562
152986789 561 QK 562
218890507 561 QK 562
77460574  561 AK 562
70731940  561 VK 562
146306528 561 KK 562
146283295 561 HK 562
226945081 561 GV 562
120554513     --    
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap