Conserved Protein Domain Family
PRK05674

?
PRK05674: PRK05674 
gamma-carboxygeranoyl-CoA hydratase; Validated
Statistics
?
PSSM-Id: 168168
View PSSM: PRK05674
Aligned: 18 rows
Threshold Bit Score: 462.74
Threshold Setting Gi: 226946950
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116049964   1 MSEFQTIQLEIDPRGVATLWLDRAEKNNAFNAVVIDELLQAIDRVGSDPQVRLLVLRGRGRHFCGGADLAWMQQSVDLDY 80 
15597209    1 MSEFQTIQLEIDPRGVATLWLDRAEKNNAFNAVVIDELLQAIDRVGSDPQVRLLVLRGRGRHFCGGADLAWMQQSVDLDY 80 
152986041   1 MSEFQTIQLEIDPRGVATLWLDRAEKNNAFNAVVIDELLQAIDRVGSDPQVRLLVLRGRGRHFCGGADLAWMQQSVDLDY 80 
229591324   1 MSDFNTLELITDSRGFATLWLSREAKNNAFNAEMIRELIIALDQVQGDPSLRFLVLRGRGKHFSAGADLAWMQQSAELDY 80 
70731297    1 MSDFNTLELLRDPRGFATLWLSREDKNNAFNAEMIRELILALDQVQGDPSLRFLLLRGRGRHFSAGADLAWMQQSAELDY 80 
146307059   1 MTDFTTIELEKDPRGFATLWLNRPEKNNAFNAAMIRELILALDAVGEDRSLRFLLLRGRGKHFSAGADLAWMQQAAELDY 80 
146283540   1 MTDFQTIELNKDARGVATLWLNRADKNNAFDAQVIGELNAALAQVQDDAGIRFLILRGRGKHFSAGADLGWMRESAKLDY 80 
71737876    3 STSFATIELITDPRGFATLWLNRPDKNNAFNAQMIRELILALDQVQSDAGLRFLLVRGRGRHFSAGADLAWMQQAAELDY 82 
66045704    3 STSFATIELINDPRGFATLWLNRSDKNNAFNAQMIRELIIALDQVQGDASLRFLLLRGRGRHFSAGADLAWMQQAADLDY 82 
28869924    3 STSFATIELLHDPRGFATLWLNRADKNNAFNAQMIRELILALDQVQGNAGLRFLLIRGRGRHFSAGADLAWMQQAADLDY 82 
116049964  81 QGNLADAQRIAELMTHLYNLPKPTLAVVQGAVFGGGVGLVSCCDMAIGSDDATFCLSEVRIGLIPATIAPFVVKAIGQRA 160
15597209   81 QGNLADAQRIAELMTHLYNLPKPTLAVVQGAVFGGGVGLVSCCDMAIGSDDATFCLSEVRIGLIPATIAPFVVKAIGQRA 160
152986041  81 QGNLADAQRIAELMTHLYNLPKPTLAVVQGAVFGGGVGLVSCCDMAIGSDDATFCLSEVRIGLIPATIAPFVVKAIGQRA 160
229591324  81 HTNLDDARELAELMYNLAKLKIPTLAVVQGAAYGGALGLISCCDMAIGADDAQFCLSEVRIGLAPAVISPFVVQAIGERA 160
70731297   81 HTNLDDARELAELMYNLAKLKIPTLAVVQGAAFGGALGLISCCDMAIGSDEAQFCLSEVRIGLAPAVISPFVVQAIGERA 160
146307059  81 NANLSDARELAELMYNLAALKIPTLAVVQGAAFGGAVGLVSCCDMAIGAEDSLFSLSEVRIGLAPAVISPFVVQALGERA 160
146283540  81 QANLADAHELGELMQRLYQLPQPTLAVVQGAAFGGALGLIACCDMAIGARDALFCLSEVRIGLAPAVISPYVVKAIGERA 160
71737876   83 NTNLDDARELAELMYSLAKLKIPTLAVVQGAAFGGALGLISCCDMAIATADAQFCLSEVRIGLAPAVISPFVVQAIGERA 162
66045704   83 NTNLDDARELAELMYSLARLKIPTLAVVQGAAFGGALGLISCCDMAIAAADAQFCLSEVRIGLAPAVISPFVVQAIGERA 162
28869924   83 NTNLDDARELAELMYNLARLKIPTLAVVQGAAFGGALGLISCCDMAIAAEDAQFCLSEVRIGLAPAVISPFVVQAIGERA 162
116049964 161 ARRYSLTAERFDGRRASELGLLSESCPAAELESQAEAWIANLLQNSPRALVACKALYHEVEAAELSPALRRYTEAAIARI 240
15597209  161 ARRYSLTAERFDGRRASELGLLSESCPAAELESQAEAWIANLLQNSPRALVACKALYHEVEAAELSPALRRYTEAAIARI 240
152986041 161 ARRYSLTAERFDGRRASELGLLSESCPAAELESQAEAWIANLLQNSPRALVACKALYHEVEAAELSPALRRYTEAAIARI 240
229591324 161 ARRYALTAERFGGQRARDIGLLAESYPIGELDHQVEQWIANLLHNSPAAMRASKDLLREVGNGALTPALRRYCENAIARI 240
70731297  161 ARRYALTAERFGGQRAREIGLLAESYPAAELDQQVQQWVDNLLLNSPQAMRASKDLLREVGNGALTTALRRYCENAIARI 240
146307059 161 AKRYALTAERFDGHRARELGLLAETCPAAELDAQAEAWIANLLLNSPQAMRASKDLLREVGSGELTPALRRYTENAIARL 240
146283540 161 TRRYALTAERFDGTRARELGLLADTYPASELDAALEQWVANLLLNSPQALKACKDLLLEVGDGDFSADLRQTTEQAIARL 240
71737876  163 ARRYALTAERFDGQRAQQMGLIAECYPAADLQARTQEWIDNLLLNSPQAMRVSKELLREVGSGELTPALRRYCESAIARI 242
66045704  163 ARRYTLTAERFDGQRAQQIGLVAECYPAAELQDRTLQWVDNLLLNSPQAMRVSKELLREVGSGVLTPALRRYCESAIARI 242
28869924  163 TRRYALTAERFDGRQARHIGLIAECYPVADLEHQTLGWIDNLLLNSPQAMRISKELLREVGSGELTPALRRYCESAIARI 242
116049964 241 RISPEGQEGLRAFLEKRTPAWRNDA 265
15597209  241 RISPEGQEGLRAFLEKRTPAWRNDA 265
152986041 241 RISPEGQEGLRAFLEKRTPAWRNDA 265
229591324 241 RVSAEGQEGLRAFLQKRPPSWQPQE 265
70731297  241 RVSAEGQEGLRAFLEKRPPSWQSET 265
146307059 241 RVSAEGQEGLRAFLEKRTPAWQEQQ 265
146283540 241 RTSPEGQEGLSAFLEKRTPAWQEKK 265
71737876  243 RTSAEGQEGLRAFLQKRTPGWHPHG 267
66045704  243 RTSAEGQEGLRAFLQKRTPGWQPVK 267
28869924  243 RTSAEGQEGLRAFLQKRTPGWQQRD 267
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap