Conserved Protein Domain Family
PRK05671

?
PRK05671: PRK05671 
aspartate-semialdehyde dehydrogenase; Reviewed
Statistics
?
PSSM-Id: 168165
View PSSM: PRK05671
Aligned: 18 rows
Threshold Bit Score: 538.159
Threshold Setting Gi: 146282141
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66044905    1 MSQSFDIAVVGATGTVGETVVQVLEERNFPVGNLYLLASIESAGHSVPFRGKNVRVREVDEFDFSKVRMAFFAAGPAVSR 80 
116051112   1 MSQPLNVAVVGATGSVGEALVGLLDERDFPLHRLHLLASAESAGQRMGFAESSLRVGDVDSFDFSSVGLAFFAAAAEVSR 80 
15598312    1 MSQPLNVAVVGATGSVGEALVGLLDERDFPLHRLHLLASAESAGQRMGFAESSLRVGDVDSFDFSSVGLAFFAAAAEVSR 80 
152988959   1 MSQPLNVAVVGATGSVGEALVGLLDERDFPLHRLHLLASAESAGQRMSFAESSLRVGDIAAFDFSSVGLAFFAAGAEVSR 80 
218890683   1 MSQPLNVAVVGATGSVGEALVGLLDERDFPLHRLHLLASAESAGQRMGFAESSLRVGDVDSFDFSSVGLAFFAAAAEVSR 80 
77458121    1 MTQTLDIAVIGATGTVGETLVQILEERDFPVGTLHLLASSESAGSSVLFRNKNVRVREVDEFDFSKVKLAFFAAGPAITL 80 
229591620   7 MNPTFDIAVIGATGTVGETLVQILEELDFPVGTLHLLAGSNSAGASVPFRGKNVRVREVDEFDFSKVQLAFFAAGPAVTS 86 
70729442    1 MTPSLDIAVIGATGTVGETLVQILEERDFPVANLHLLASSESAGHSVPFRGKNVRVREVDEFDFSKVQLAFFAAGPAVTL 80 
146307741   1 MSQSINIALIGATGNVGEALVELLEERDFPVKDLHLLASSESAGQSLSFRGRQVRVRSLEAFDFTQVQLAFFAAGAEVTR 80 
28870973    1 MSQSFDIAVVGATGTIGETVVQVLEERHFPVGNLHLLASIESAGHSVPFRGKNVRVREVDAFDFSQVRLAFFAAGPAISR 80 
66044905   81 SHAEKAVAAGSTVIDLSGTFTSTQAPNVVPEINATLLHSrGVVPCLVASPSASATAVALALAPLRGLIDIQSVTVTACLA 160
116051112  81 AHAERARAAGCSVIDLSGALEPSVAPPVMVSVNAERLAS-QAAPFLLSSPCAVAAELCEVLAPLLATLDCRQLNLTACLS 159
15598312   81 AHAERARAAGCSVIDLSGALEPSVAPPVMVSVNAERLAS-QAAPFLLSSPCAVAAELCEVLAPLLATLDCRQLNLTACLS 159
152988959  81 AHAERAHAAGCSVIDLSGALESACAPLVMASVNEQRLAG-LQAPFMLSSPCAPAAELCEVLNPLLGALDCRQLNLTACLS 159
218890683  81 AHAERARAAGCSVIDLSGALEPSVAPPVMVSVNAERLAS-QAAPFLLSSPCAVAAELCEVLAPLLATLDCRQLNLTACLS 159
77458121   81 SYAARAHAAGCSLVDLSGALPADQAPQVVPEANADVLAG-LKAPFQVCSPSPSATTLAVVLAPLLDLIELHYVHVTANLA 159
229591620  87 SFAPRATAAGCSLIDLSGALPAEQAPQVVPEANAHVLDG-LSKPFQLGSPSPSATNLAVVLAPLRSVLDIQRVSVTASLA 165
70729442   81 SFAPRATAANCAVIDLSGALSSAQAPNVVPEANAQVLAG-LKKPLQLSSPSASATALAVALAPLQGLLDIQRVNLTASLA 159
146307741  81 AYHETVLAAGCSLIDLSSALPLEHAPCVLPELGIEGLPA-LAKPWKVSAPTPSAVACALVLATLKPLLQPQQLQLTAMLS 159
28870973   81 SYAEKAIAAGCSVIDLSGAFPSAQAPNVVPEINATLLNTcGVAPHLVASPSASATAVALALAPLRALLDIQSVAVTACLA 160
66044905  161 VSALGREGVSELARQTTELLNVRPLETRFFDRQMAFNLLAQVGTPDASGHLPLERRLVEELRELLALPSLKVSATCIQVP 240
116051112 160 VSSLGREGVKELARQTAELLNARPLEPRLFDRQIAFNLLAQVGAVDGEGHSAIERRIFAEVQALLGERIGPLNVTCIQAP 239
15598312  160 VSSLGREGVKELARQTAELLNARPLEPRLFDRQIAFNLLAQVGAVDAEGHSAIERRIFAEVQALLGERIGPLNVTCIQAP 239
152988959 160 VSSRGREGVRELARQTAELLNARPLEPRLFDRQVAFNLLAQVGAVDAQGHSEIERRIFAEVRALLGERVGPLNVTCIQAP 239
218890683 160 VSSLGREGIKELARQTAELLNARPLEPRLFDRQIAFNLLAQVGAVDAEGHSAIERRIFAEVQALLGERIGPLNVTCIQAP 239
77458121  160 VSAQGREAVTELARQTAELLNMRPLEPTFFDRQMAFNLLAQVGTPDAQGHTLLEKRLVRELRQVLAKPLLKISATCVQAP 239
229591620 166 MSSQGREAVSELARQTAELLNMRPLEPKFFDRQVAFNVLAQVGTPDAQGHTALEKRLVHELRAVLELPLLKISATCVQAP 245
70729442  160 ISSQGREAVSELARQTAELLNVRPMEPRFFDRQVAFNLLAQVGTPDAQGHTLLEKRLVRELREVLGQPLLKISVTCIQAP 239
146307741 160 MSTLGRSGVQELARQTAELLNARPLEPKGVDRQVAFNVLAQVGAVDEQGHAELERRLAAEIRQLLGLPALSVAATCALVP 239
28870973  161 VSALGREGVSELARQTTELLNVRPLETRFFDRQMAFNVLAQVGKPDESGHLSLEKRLVDELRELLALPSLKVSATCIQVP 240
66044905  241 VFFGDSFTVALRTAGAVDVAAVNAALESADGVELVDAGDYPTPVGDAVGQDVVYVGRVRTGTDDSEQLNLWLTSDNVRKG 320
116051112 240 VFFGDSLSVTLQCAEPVDLAAVTRVLDATKGIEWVGEGDYPTVVGDALGQDETYVGRVRAGQADPCQVNLWIVSDNVRKG 319
15598312  240 VFFGDSLSVTLQCAEPVDLAAVTRVLDATKGIEWVGEGDYPTVVGDALGQDETYVGRVRAGQADPCQVNLWIVSDNVRKG 319
152988959 240 VFFGDSLSVTLQCAEPVDLATLTAILEATKGIEWVGDGDYPTVVGDALGQDEIYVGRVRAGQGDPCQVNLWIVSDNVRKG 319
218890683 240 VFFGDSLSVTLQCAEPVDLAAVTRVLDATKGIEWVGEGDYPTVVGDALGQDETYVGRVRAGQADPCQVNLWIVSDNVRKG 319
77458121  240 VFFGDSFSVTLQSASAVDLEKVNAALEEAEGIELVEAGDYPTAVGDAVGQDVVYVGRVRAGVDEPSELNLWLTSDNVRKG 319
229591620 246 VFFGDSLTVSLQLGAPVDLAAVNRLLDAAPGIELVDEGDYPTAVGDAVGQDVIYVGRVRAGVDDPAELNLWLTSDNVRKA 325
70729442  240 VFFGDSYSVTLQSGSAVDLAAVNAALEAAPGLELVEAGDYPTAVGDAVGQDVVYVGRVRSGVDDPTELNLWLTSDNVRKG 319
146307741 240 VFFGDSLALSVQGDADIDITAVQQLLDGAQGIELVEAGDYPTAVGDAVGQDQVYVGRVRAGISDPRQLNLWIASDNVRKG 319
28870973  241 VFFGDSFTVALRTAGPVDVVAVNAALESADGIELVDAGDYPTPVGDAVGQDVVYVGRVRAGTDDPEQLNLWLTCDNVRKG 320
66044905  321 AALNAVQVGELLIKDYV 337
116051112 320 AALNAVLLGELLIKHYL 336
15598312  320 AALNAVLLGELLIKHYL 336
152988959 320 AALSAVLLGELLIKHYL 336
218890683 320 AALNAVLLGELLIKHYL 336
77458121  320 AALNAVQVAELLIKDLL 336
229591620 326 AALNAVQLAQLLIKGLA 342
70729442  320 AALNAVQLAELLIKDLL 336
146307741 320 AALNAVQIAELLIKHYL 336
28870973  321 AALNAVQVGELLIKDYV 337
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap