Conserved Protein Domain Family
PRK05665

?
PRK05665: PRK05665 
amidotransferase; Provisional
Statistics
?
PSSM-Id: 168162
View PSSM: PRK05665
Aligned: 16 rows
Threshold Bit Score: 387.244
Threshold Setting Gi: 89901470
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116049692   1 MSLRICILETDILRPELIERYEGYGRMFQQLFAKQPIAAEFVIYNVVEGRYPADDERFDAYLVTGSKADSFGPDPWIQTL 80 
15596939    1 MSLRICILETDILRPELIERYEGYGRMFQQLFAKQPIAAEFVIYNVVEGRYPADDECFDAYLVTGSKADSFGPDPWIQTL 80 
218892305   1 MSLRICILETDILRPELIERYEGYGRMFQQLFAKQPIAAEFVIYNVVEGRYPADDERFDAYLVTGSKADSFGPDPWIQTL 80 
77457968    1 MSLRICILETDILRPELVDQYQGYGQMFQRLFSQQPIAAEFTVYNVMQGDYPSDDLTFDAYLVTGSKADSFGTDPWIQTL 80 
229592062   1 MSLRVCILETDILRPGLIDQYQGYGQMFKRLFSKQPIPAEFVVYNVVNGEYPSDDEVFDAYLVTGSKADSFGTDPWIQTL 80 
70729221    1 MSLRICILETDILRPELVDQYQGYGQMFQRLFSQQPIAAQFSVYNVVQGEYPSDDLEFDAYLVTGSKADSFGTDPWIQTL 80 
146307610   1 MSLRICILETDILRPELVDQYQGYGRMFEQLFAQQPVAAEFSVYNVVEGHYPPDSEKFDAYLVTGSKADSFGSEPWIQTL 80 
66045117    1 MSLRICILETDNLRPELVEQYHGYGRMFELLFARQPIAAELTVYNVVQGDYPPADEQFDAYLVTGSKADSFGTDPWIQTL 80 
28869267    1 MPLRICILETDNLRAELVEQYHGYGRMFERLFARQPIAAELSVYNVVQGVYPPEGEKFDAYLVTGSKADSFGTDPWIQTL 80 
104780718   1 MSLRICILETDVLRPELVAQYQGYGRMFEQLFSRQPVAAEFDVYNVMNGDYPADDAVFDAYLVTGSKADSFGSDPWIQTL 80 
116049692  81 KTFLLDRYERGDKLLGVCFGHQLLALLLGGKAERASQGWGMGIHQYQLNERADWMSPALPDLTLLISHQDQVTRLPENAR 160
15596939   81 KTFLLDRYERGDKLLGVCFGHQLLALLLGGKAERASQGWGMGIHQYQLNERADWMSPALPDLTLLISHQDQVTRLPENAR 160
218892305  81 KTFLLDRYERGDKLLGVCFGHQLLALLLGGKAERASQGWGMGIHQYQLNERADWMSPALPDLTLLISHQDQVTRLPENAR 160
77457968   81 KQYLLTRYERGDKLLGVCFGHQLLALLLGGKSERATQGWGVGIHNYKLAAKAPWMSPVREELTLLISHQDQVTALPENAT 160
229592062  81 KTYLLERYERGDKLLGICFGHQLLALLLGGKAERASQGWGIGIHDYKLDAKAPWMSPEVEELTLLISHQDQVTTLPENAT 160
70729221   81 KTYLLGRYERGDKLLGICFGHQLLALLLGGKSERASQGWGVGTHSYKLSAKAPWMSPVVEELTLLISHQDQVTALPENAT 160
146307610  81 KEYLLERYKRGDKLLGICFGHQLLALLLGGKAERAEQGWGVGVHSYRLEGKPEWMSPALDELQLLISHQDQVTRLPEKAT 160
66045117   81 KVYLLELYQRGEKLLGICFGHQLLALLLGGRTERAVQGWGVGIHHYQLAPARPWMTPAMDKLTLLISHQDQVTALPENAT 160
28869267   81 KVYLLELYQRGEKLLGICFGHQLLALLLGGKTERAAQGWGVGIHHYQLAPARPWMTPAMDNLTLLISHQDQVTALPEQAT 160
104780718  81 KAYLLKLYERGEKLLGVCFGHQLLALTLGGKAERADKGWGVGIHRYSLAAHAPWMDPEVTELTLLISHQDQVTEVPEGAT 160
116049692 161 VIASSDFCPYAAYAIGDQVLCFQGHPEFVHDYSRELLELRQQHLGEELYRKGVDSLARDHQGTVVAEWMMRFVARQPTGA 240
15596939  161 VIASSDFCPYAAYAIGDQVLCFQGHPEFVHDYSRELLELRQQHLGEELYRKGVDSLARDHQGTVVAEWMMRFVARQPTGA 240
218892305 161 VIASSDFCPYAAYAIGDQVLCFQGHPEFVHDYSRELLELRQQHLGEELYRKGVDSLAGDHQGTVVAEWMMRFVARQPTGA 240
77457968  161 VIASSDFCPFAAYHINDQVLCFQGHPEFIHDYSRALLDLRQEALGEQVYSKGVASLEHQHHGTTVAEWMMRFVAHKPTAA 240
229592062 161 VIASSAFCPFAAYHIGDQVLCFQGHPEFIHDYSRELLEILQTTLGEKVYTNGVASLERDHHGATVAEWMMRFVAHKPEAQ 240
70729221  161 VIASSDFCPFAAYHINDQVLCFQGHPEFIHDYSRALLDLRQEFLGEQIYQKGVASLEHDHHGTTVAEWMMRFVAHKPEAA 240
146307610 161 LLASSDFCPIGAYHIEDQVLCFQGHPEFVHDYSRALLDLRQQHLGEQVYQRGVDSLKHSQQGSAVAEWMMRFVAQGKEAK 240
66045117  161 VLASSEFCPFAAYHINDQVLCFQGHPEFIHDFSRTLLDLRQEALGEQIYKQGVASLDHDHHGATVAEWMMRFVAHKPEKQ 240
28869267  161 VIASSEFCPFAAYHINDQVLCFQGHPEFIHDFSRTLLDLRQEALGEQVYKQGVASLDHDHHGATVAEWMMRFVAHKPDNQ 240
104780718 161 VIASSDFCPNAAYHIRDQVLCFQGHPEFVHDYSRALLDARQDFLGEEVYQKAVASLASEHQGDLVGEWMLRFIQQPAKTG 240
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap