Conserved Protein Domain Family
PRK05659

?
PRK05659: PRK05659 
sulfur carrier protein ThiS; Validated
Statistics
?
PSSM-Id: 168159
View PSSM: PRK05659
Aligned: 29 rows
Threshold Bit Score: 105.203
Threshold Setting Gi: 190575626
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116054110  1 MQIQLNGEPFELPDAQSVADLLARLELGGRRVAVELNLDIVPRSQHASTALKDGDRVEIVHAIGGG 66 
58582994   1 MNIQLNGSLRTLPDNLSLTALLDQEGLAQRRVAVEVNGEIVSRGRHAEHALHEGDVVEIVHALGGG 66 
84624833   1 MNIQLNGSLRTLPDNLSLTALLDQEGLAQRRVAVEVNGEIVSRGRHAEHALHEGDVVEIVHALGGG 66 
188577820  1 MNIQLNGSLRTLPDNLSLTALLDQEGLAQRRVAVEVNGEIVSRGRHAEHALHEGDVVEIVHALGGG 66 
66767348   1 MNIQLNGTPRTLPDDVLLSALLELEGLSQRRVAVEVNGEIVSRGLHATHALREGDVVEIVHALGGG 66 
188990425  1 MNIQLNGTPRTLPDNVLLSALLELEGLSQRRVAVEVNGEIVSRGLHATHALREGDVVEIVHALGGG 66 
15837384  10 MNIQLNGQCRRIPETSSIAGLLAEEGFSERRVAVEVNGEIVPRTLHLNYVLREGDRVEIVHALGGG 75 
28199747   1 MNIQLNGQCRCIPETSSIAGLLAEEGFSERRVAVEVNGEIVPRTLHVNYVLREGDRVEIVHALGGG 66 
170731125 33 MNIQLNGQCRCIPETSSIAGLLAEEGFSERRVAVEVNGEIVPRTLHVNYVLREGDRVEIVHALGGG 98 
194366961  1 MNIQLNGEPRTLPASATLHDLLEAEQLLQRRVAVEVNGEIVSRSRHGEHVLAEGDVVEIVHALGGG 66 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap