Conserved Protein Domain Family
PRK05645

?
PRK05645: PRK05645 
lysophospholipid acyltransferase
Statistics
?
PSSM-Id: 135493
View PSSM: PRK05645
Aligned: 17 rows
Threshold Bit Score: 585.717
Threshold Setting Gi: 152985637
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116053731   1 MEKFKGALVVGALRLFALLPWRAVQGVGAGIGWLMWKLPNRSREVVRINLSKCFPELSETELEKLVGQSLMDIGRTLTES 80 
15595209    1 MEKFKGALVVGALRLFALLPWRAVQGVGAGIGWLMWKLPNRSREVVRINLSKCFPELSETELEKLVGQSLMDIGRTLTES 80 
152985637   1 MEKFKGALVVGALRLFALLPWRAVQGVGAGIGWLMWKLPNRSREVVRINLSKCFPELSEAELEKLVGQSLMDIGKTLTES 80 
218888757   1 MEKFKGALVVGALRLFALLPWRAVQGVGAGIGWLMWKLPNRSREVVRINLSKCFPELSETELEKLVGQSLMDIGRTLTES 80 
229587591   1 MEKFKGALLVGALRLFALLPWRAVQAVGTAIGWIMWKTPNRSRDTVRINLSKCFPDMDPAARERLVGQSLKDIGKSLTES 80 
70733529    1 MDKFKGALLVGALRLFALLPWRAVQAVGAAIGWIMWKTPNRSREVVRINLAKCFPQMDPAERERLVGQSLKDIGKSLTES 80 
162286125   1 MEAFKGRLVVGFLRLFALLPWRAVQAVGNAIGWLMWKLPNGSRDVVRINLSKCFPELNQAELDRLVGQSLKDIGKTLTES 80 
71737788    1 MDKFKGAVMVGALRLFALLPWRAVQWAGTAIGWLMWKLPNRSREVARINLSKCFPELSEPELEKLVGRSLMDIGKTLTES 80 
66043285    1 MDKFKGAVMVGALRLFALLPWRAVQWTGTAIGWLMWKLPNRSREVARINLSKCFPELSEPELEKLVGRSLMDIGKTLTES 80 
28867422    1 MDKFKGAVMVGALRLFALLPWRAVQWVGTAIGWLMWKLPNRSREVARINLSKCFPELSEPELEKLVGRSLMDIGKTLTES 80 
116053731  81 ACAWIWPPEKSLRYIREVEGMEVLEEALASGDGLVGITSHLGNWEVLNHFYCSYAKPIIFYRPPKLKAVDELLKKQRVQL 160
15595209   81 ACAWIWPPEKSLRYIREVEGMEVLEEALASGDGLVGITSHLGNWEVLNHFYCSYAKPIIFYRPPKLKAVDELLKKQRVQL 160
152985637  81 ACAWIWPPEKSLKYIREVEGMEVLEEALASGDGLVGITSHLGNWEVLNHFYCSYAKPIIFYRPPKLKAVDELLKKQRVQL 160
218888757  81 ACAWIWPPEKSLRYIREVEGMEVLEEALASGDGLVGITSHLGNWEVLNHFYCSYAKPIIFYRPPKLKAVDELLKKQRVQL 160
229587591  81 ACAWIWPAQRSIDLVREVEGLEVLHEALASGKGVVGITSHLGNWEVLNHFYCSQCKPIIFYRPPKLKAVDELLRKQRVQL 160
70733529   81 ACAWIWPAERSIALVREVEGLEVLKDALASGKGVVGITSHLGNWEVLNHFYCSQCKPIIFYRPPKLKAVDELLRKQRVQL 160
162286125  81 ACAWIWPAQKSLKLIREVEGLEVLQQALASGKGVVGITSHLGNWEVLNHFYCNQCKPIIFYRPPKLKAVDELLQQQRVQM 160
71737788   81 ACAWIWPAQKSINLVREVEGLDVLKDALASGKGVVGITSHLGNWEVLNHFYCSQCKPIIFYRPPKLKAVDDLLRKQRVQL 160
66043285   81 ACAWIWPAQKSIDLVREVEGLDVLKDALASGKGVVGITSHLGNWEVLNHFYCSQCKPIIFYRPPKLKAVDDLLRKQRVQL 160
28867422   81 ACAWIWPAQKSINLVREVEGLEVLKDALASGKGVVGITSHLGNWEVLNHFYCSQCKPIIFYRPPKLKAVDDLLRKQRVQL 160
116053731 161 GNRVAPSTPEGILSVIKEVKKGGCVGIPADPEPARTAGLFVPYLGTTALISKFVPQLLSRGKARGVFFHAVRLPDGSGYK 240
15595209  161 GNRVAPSTPEGILSVIKEVKKGGCVGIPADPEPARTAGLFVPYLGTTALISKFVPQLLSRGKARGVFFHAVRLPDGSGYK 240
152985637 161 GNRVAPSTPEGILSVIKEVKRGGCVGIPADPEPARTAGLFVPYLGTTALISKFVPQLLSRGKARGVFFHAVRLPDGSGYK 240
218888757 161 GNRVAPSTPEGILSVIKEVKKGGCVGIPADPEPARTAGLFVPYLGTTALISKFVPQLLSRGKARGVFFHAVRLPDGSGYK 240
229587591 161 GNRVAASTKEGILSVIKEVRKGGQVGIPADPEPAESAGIFVPFFATQALTSKFVPNMLAGHKAVGVFLHALRLPDGSGYK 240
70733529  161 GNRVAASTKEGILSVIKEVRKGGAVGIPADPEPAESAGIFVPFFATQALTSKFVPNMLAGGKAVGVFLHALRLPDGSGYK 240
162286125 161 GNRVAPSTKEGILSVIKEVRKGGAVGIPADPEPSRSAGVFVPFLGTTALTSKFVPGMLTGGKAVGVFLHALRLPDGSGYK 240
71737788  161 GNRVAASTKEGILSVIKEVRKGGSVGIPADPEPAESAGIFVPFCGTQALTSKFVPNMLAGGKAVGVFLHAMRLPDGSGYK 240
66043285  161 GNRVAASTKEGILSVIKEVRKGGSVGIPADPEPAESAGIFVPFCGTMALTSKFVPNMLAGGKAVGVFLHAMRLPDGSGYK 240
28867422  161 GNRVAASTKEGILSVIKEVRKGGSVGIPADPEPAESAGIFVPFCGTQALTSKFVPNMLAGGKAVGVFLHAMRLPDGSGYK 240
116053731 241 VILEAAPADMYDKDLEVSVAAMSRELAKYVRAYPSQYMWSMKRFKNRPDGEKKWY 295
15595209  241 VILEAAPADMYDKDLEVSVAAMSRELAKYVRAYPSQYMWSMKRFKNRPDGEKKWY 295
152985637 241 VILEAAPADMYDKDLDVSVAAMSRELAKYVRAYPSQYMWSMKRFKNRPDGEKKWY 295
218888757 241 VILEAAPADMYDKDLEVSVAAMSRELAKYVRAYPSQYMWSMKRFKNRPDGEKKWY 295
229587591 241 VILEAAPEDMYSTDTATSCAAMSKVVERYVGAYPSQYMWSMKRFKKRPPGEERWY 295
70733529  241 VILEAAPEDMYSTDTETSCAAMSKVVERYVGAYPSQYMWSMKRFKKRPPGEARWY 295
162286125 241 VILEAAPEGMYSENVEEGVAAMSEVVSRYVRNYPSQYMWSMKRFKKRPDGEAKWY 295
71737788  241 VVLEAAPEAMYSTDTETSAAAMSKVVEKYVRAYPSQYMWTMKRFKKRPAGEARWY 295
66043285  241 VVLEAAPEAMYSTDTETSAAAMSKVVEKYVRAYPSQYMWTMKRFKKRPPGEARWY 295
28867422  241 VVLEAAPEAMYSTDTQTSAAAMSKVVEKYVRAYPSQYMWTMKRFKKRPPGEARWY 295
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap