Conserved Protein Domain Family
PRK05642

?
PRK05642: PRK05642 
DnaA regulatory inactivator Hda
Statistics
?
PSSM-Id: 168147
View PSSM: PRK05642
Aligned: 18 rows
Threshold Bit Score: 415.419
Threshold Setting Gi: 146283163
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116048871   1 MKPIQLPLSVRLRDDATFANYYPGANAAALGYVERLCEAEAGWAESLIYLWGHDGVGRSHLLQAACLRFEQFEERTIYLP 80 
15596144    1 MKPIQLPLSVRLRDDATFANYYPGANAAALGYVERLCEAEAGWAESLIYLWGHDGVGRSHLLQAACLRFEQFEERTIYLP 80 
152987343   1 MKPIQLPLSVRLRDDATFANYYPGANAAALGYVERLCEAEAGWAESLIYLWGHDGVGRSHLLQAACLRFEQFEERTIYLP 80 
218893083   1 MKPIQLPLSVRLRDDATFANYYPGANAAALGYVERLCEAEAGWAESLIYLWGHDGVGRSHLLQAACLRFEQFEERTIYLP 80 
229591907   1 MKPIQLPLGVRLRDDATFINYYPGANAAALGYVERLCEADAGWTESLIYLWGKHGVGRTHLLQAACLRFEQMGEPAVYLP 80 
70731783    1 MKPIQLPLGVRLRDDATFINYYPGANAAALGYVERLCEADAGWTESLIYLWGKDGVGRTHLLQAACLRFEQLGEPAVYLP 80 
146308015   1 MKPIQLPLGVRLRDDATFANYYPGANAAALGYVERLCEADAGWTESLIYLWGAEGVGRSHLLQAACLRFEQRGDAVVYLP 80 
71734306    1 MKPIQLPLSVRLRDDATFVNYYPGANAAALGYVERLCEADAGWTESLIYLWGKDGVGRTHLLQAACLRFEQLGEPAVYLP 80 
66046915   28 MKPIQLPLSVRLRDDATFVNYYPGANAAALGYVERLCEADAGWTESLIYLWGKDGVGRTHLLQAACLRFEQLGEPAVYLP 107
28868909    1 MKPIQLPLSVRLRDDATFVNYYPGANAAALGYVERLCEADAGWTESLIYLWGKDGVGRTHLLQAACLRFEQLGEPAVYLP 80 
116048871  81 MADLVQYGPEIFDDLEQCELVCIDDLDVLVGKREWEEGLFHLFNRLRDTGRRLLLAASKSPRELQVKLPDLKSRLTMALI 160
15596144   81 MADLVQYGPEIFDDLEQCELVCIDDLDVLVGKREWEEGLFHLFNRLRDTGRRLLLAASKSPRELQVKLPDLKSRLTMALI 160
152987343  81 MADLVQYGPEIFDDLEQCELVCIDDLDVLVGKRNWEEGLFHLFNRLRDTGRRLLLAASKSPRELQVKLPDLKSRLTMALI 160
218893083  81 MADLVQYGPEIFDDLEQCELVCIDDLDVLVGKREWEEGLFHLFNRLRDTGRRLLLAASKSPRELQVKLPDLKSRLTMALI 160
229591907  81 LAELMDRGIGIFDHLEQYELVCLDDLQAIAGKADWEEALFHLFNRLRDSGRRLLIAASSSPRELPIKLADLKSRLTLALI 160
70731783   81 LAELLDRGIEILDNLEQYELVCLDDLQAVAGKADWEEALFHLFNRLRDSGRRLLIAASTSPRELPVKLADLKSRLTLALI 160
146308015  81 LTEVVQHGPELLDNLELCELVCLDDLDAVAGRSDWEEGLFHLFNRLRDSGRRLLLAGTMSPRELPIQLPDLKSRLTLALV 160
71734306   81 LAEVIDEGIELFDHLEQYELVCLDDLQAIVGKPEWEEALFHLFNRLRDSGRRLLIAASKSPRELPVKLPDLKSRLTMALV 160
66046915  108 LAEVIDEGIELFDHLEQYELVCLDDLQAIVGKPDWEEALFHLFNRLRDSGRRLLIAASKSPRELPVKLPDLKSRLTMALV 187
28868909   81 LAEVIDEGIELFDHLEQYELVCLDDLQAIVGKPEWEEALFHLFNRLRDSGRRLLIAASKSPRELPVKLPDLKSRLTMALV 160
116048871 161 FQLHGLSDEDKLRALQLRASRRGLHLTDEVGRFILNRGSRSMNSLFDLLEQLDRASLQAQRKLTIPFLKETLGW 234
15596144  161 FQLHGLSDEDKLRALQLRASRRGLHLTDEVGRFILNRGSRSMNSLFDLLEQLDRASLQAQRKLTIPFLKETLGW 234
152987343 161 FQLHGLSDEDKLRALQLRASRRGLHLTDEVGRFILNRGSRSMNSLFDLLEQLDRASLQAQRKLTIPFLKETLGW 234
218893083 161 FQLHGLSDEDKLRALQLRASRRGLHLTDEVGRFILNRGSRSMNSLFDLLEQLDRASLQAQRKLTIPFLKETLGW 234
229591907 161 FQMRPLSDEDKLRALQLRASRRGLHLTDEVGHFILTRGTRSMSALFDLLEQLDQASLQAQRKLTIPFLKETLGW 234
70731783  161 FQMRPLSDEDKLRALQLRASRRGLHLTDEVGHFILTRGTRSMSALFELLERLDQASLQAQRKLTIPFLKETLGW 234
146308015 161 FQLHELSDEDKLRALQLRASRRGLQMSDEVGRFILTRGERSMSALFELLERLDQASLQAQRKLTIPFLKETLGW 234
71734306  161 FQMRGLSDEDKLRALQLRASRRGLHLTDEVGHFILTRGTRSMSALFELLERLDQASLQEKRKLTIPFLKETLGW 234
66046915  188 FQMRGLSDEDKLRALQLRASRRGLHLTDDVGHFILTRGTRSMSALFELLERLDQASLQEKRKLTIPFLKETLGW 261
28868909  161 FQMRGLSDEDKLRALQLRASRRGLHLTDDVGHFILTRGTRSMSALFELLERLDQASLQEKRKLTIPFLKETLGW 234
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap