Conserved Protein Domain Family
PRK05640

?
PRK05640: PRK05640 
putative monovalent cation/H+ antiporter subunit B; Reviewed
Statistics
?
PSSM-Id: 101884
View PSSM: PRK05640
Aligned: 3 rows
Threshold Bit Score: 187.722
Threshold Setting Gi: 18977522
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18977522   5 ILEIITGIIAVTLALITVLHKKFLASLISYSLASLLLALLAMTFRAPDVALSLIVVGALVIGLFIFAHEETREEiKIDLK 84 
14521410   1 MLGTMLSFMIILLALTVVLHRDFLASLIAYSLVGLSFVMLAVLARAPDVALSAIAVGGIVIGLFIFAYEKVREE-GIELP 79 
14590795   1 MLGIILEVVMLTLALIVILHRDFMTSLIVYSLTSLVFILLVLLSYAPDVALSGIVVGGIVTGLFVFGYERAGGEcKVKLP 80 
18977522  85 PGIAVIPLLLLLLKTRITPNSLTYEAYLSVWNLGNLVTEILAGWRFYDSVGEALILFSAAVGFSIVVRRVK 155
14521410  80 LGLAVVPLAIALLRLRVSVNPGSYYHYIKAWSIGNLVSEILAGWRLYDSVGEALILFSAALGFSLLIRGKK 150
14590795  81 LGLAVLPLAFALLRVKFKVNLASYEAYVKAWNINNLVSEILAGWRLYDSVGEALILFSAALGFSLLMGGRK 151
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap