Conserved Protein Domain Family
PRK05639

?
PRK05639: PRK05639 
acetyl ornithine aminotransferase family protein
Statistics
?
PSSM-Id: 168145
View PSSM: PRK05639
Aligned: 5 rows
Threshold Bit Score: 901.997
Threshold Setting Gi: 18976885
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18976885    1 MEYPKIITKLPGPKATEIIERESRILSPGIGVKLFPLVPKRGFGALIEDVDGNIFIDFLAGAAAASTGYSHPKLVKAVQE 80 
14521482    1 MDYPRIVVNPPGPKAKELIEREKRVLSTGIGVKLFPLVPKRGFGPFIEDVDGNVFIDFLAGAAAASTGYSHPKLVKAVKE 80 
14590650   18 MEYPKIVVKPPGPRAKELIEREKKVLSTGIGVKLFPLVPKRGFGPFIEDVDGNVFIDFLAGAAAASTGYAHPKLVKAVKE 97 
242398987   1 MEYPKLVVTPPGPKAKELVEREKRVISQGLGVKLFPVVPERGYGALIEDVDGNVFIDFLAGAAAASTGYAHPKLVKEVQE 80 
240102365   3 SDYPRIVVKPPGPRAKKLIERERSAISPGLGVKLFPLVPERGRGALIEDVDGNVFIDFLAGAAAASTGYSHPKLVKEVQE 82 
18976885   81 QVALIQHSMIGYTHNERAIRVAEKLAKISPIKNPRIIFGMSGSDAVDMAIKVSKFSTRRPWILSFIGAYHGQTLGATSIA 160
14521482   81 QVELIQHSMIGYTHSERAIRVAEKLVKISPIKNSKVLFGLSGSDAVDMAIKVSKFSTRRPWILAFIGAYHGQTLGATSVA 160
14590650   98 QVELIQHSMIGYTHSERAIRVAEKLVEISPIENSKVIFGLSGSDAVDMAIKVSKFSTRRPWILAFIGAYHGQTLGATSVA 177
242398987  81 QVSKIQHSMIGYTYSKRAIEVAEILAEKSPIENPKILFGLSGSDSIDLLMKVARFATRKPWIIAFIGAYHGQTYGATSVA 160
240102365  83 QVARIQHSMIGYTHSKRAIEVAEKLIEMAPIERPLVLFGMSGSDAVDMALQAARFSTRRPWILSFIGAYHGQTYGATSVA 162
18976885  161 AFQSSQKRGFSPLMPNVIWLPYPNPYRNIWGIDGYEEPNELINRFLDYLENYVFSHLSPSDEVAALFAEPIQGDAGIVVP 240
14521482  161 SFQVSQKRGYSPLMPNVFWVPYPNPYRNPWGINGYEEPQELVNRVVEYLEDYVFSHVVPPDEVAAFFAEPIQGDAGIVVP 240
14590650  178 SFQVSQKRGYSPLMPNVFWIPYPNPFRNIWGINGYEEPDELINRVLDYLEYYVFSHVVPPDEVAALFAEPIQGDAGIVVP 257
242398987 161 AFQSSQKRGFSPLVPNVVWIPYPNPYRNVWNIDGYEEPDELINAFLDYLENYVFAHVIPPDEVSILLAEPIQGDAGIVVP 240
240102365 163 AFQSSQKRGLSPLVPNVVWVPYPNPYRNPWGINGYDEPDELINRFLDYLESYIFAHVVPPDEIALLIAEPIQGDAGIVVP 242
18976885  241 PENFFKEVQKVLNDLGILLVMDEVQTGIGRTGKWFASEWFSVEPDLIIFGKGVASGMGLSGVIGRKELMD-LTSGAALLT 319
14521482  241 PENFFKELKKLLDEHGILLVMDEVQTGIGRTGKWFASEWFEVKPDMIIFGKGVASGMGLSGVIGREDIMD-ITSGSALLT 319
14590650  258 PENFFKELKKLLEEYGILLVMDEVQTGIGRTGKWFASEWFNVKPDMIIFGKGVASGMGLSGVIGRKEIMD-ITSGSALLT 336
242398987 241 PDNFFKELKKVLDEREILLAMDEVQTGIGRTGKWFGSEWFEVEPDFISFGKGVASGMGLSGVIGKAHLME-MTSGSALLT 319
240102365 243 PEGFFAELKRLLDEHNILLAMDEVQTGIGRTGKWFASEWFGVKPDLLIFGKGVASGMGLSGVIGRRELLEnLTSGSALLT 322
18976885  320 PAANPVVSAAAEATLEIIEEENLLENALKVGNFIKKRLEEMKEVFEVIGDVRGKGLMIGVEIVKdrESKK-PDPELTGKI 398
14521482  320 PAANPVISAAADATLEIIEEENLLKNAIEVGSFIMKRLNELKEQFDIIGDVRGKGLMIGVEIVK--ENGR-PDPEMTGKI 396
14590650  337 PAANPVISAAAEATLEIIEEENLLKNALEVGEFIMGRLKEIKERFEIIGDVRGKGLMIGVEIVK--ENGR-PDPEMTGKI 413
242398987 320 PAANPVISAAAYATLRIIEEENLLKNALKVGEFIKKRLLEMKESYDVIGDVRGKGLMIGAEIVK--PNTKvPNPDLTGKI 397
240102365 323 PAANPVVSAAAKATLEIIEGENLLENALRVGEFIKKRLGEMKEDYEVIGDVRGKGLMRGAEIVK--PNGK-PDLELTGKI 399
18976885  399 CWRAFELGLILPSYGMFQNVIRITPPLVITQEIAEKGLEIMERAIKDALAGKVERKVVTWH 459
14521482  397 CWRAFELGLILPSYGMFGNVIRITPPLVLTKEVAEKGLEIIEKAIKDAIAGKVERKVVTWH 457
14590650  414 CWRAFELGLILPSYGMFGNVIRITPPLVLTKEVAEKALEIIERAIKDTLTGKVERKVVTWH 474
242398987 398 CWRAFELGLILPSYGMFGNVIRITPPLVITKKIAEKGLEIMEQALKDALAGKVKHKTITWH 458
240102365 400 CWRAFELGLILPSYGMFGNVIRITPPLVITEEIAEKGLEIMERALKDALAGKVTHRVVTWH 460
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap