Conserved Protein Domain Family
PRK05613

?
PRK05613: PRK05613 
O-acetylhomoserine/O-acetylserine sulfhydrylase
Statistics
?
PSSM-Id: 168128
View PSSM: PRK05613
Aligned: 9 rows
Threshold Bit Score: 828.358
Threshold Setting Gi: 227832341
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
68536784    1 MPKYNNENAEQWGFATRQIHAGQPVG-DTGARNLPIHFTTSYVFNDAEHAKQRFHLEDLGPIYSRLTNPTVEALENRLNS 79 
38233237    2 PTKYDNSNANKWGFETRSIHAGQSVDsDTSARNLPIYLTSSYVFNDAEHAANRFNLSDAGPVYSRLTNPTVAAVEERLAN 81 
62389543    1 MPKYDNSNADQWGFETRSIHAGQSVDaQTSARNLPIYQSTAFVFDSAEHAKQRFALEDLGPVYSRLTNPTVEALENRIAS 80 
19551884    1 MPKYDNSNADQWGFETRSIHAGQSVDaQTSARNLPIYQSTAFVFDSAEHAKQRFALEDLGPVYSRLTNPTVEALENRIAS 80 
145294828   1 MPKYDNSNADQWGFETRSIHAGQSVDaQTSARNLPIYQSTAFVFDSAEHAKQRFALEDLGPVYSRLTNPTVEALENRIAS 80 
172040103   1 MTKYDNSNAAEWGFATQQIHAGQTVD-PTGSRNLPIHMTTSYVFDSAEHAKQRFALEDPGPIYSRLTNPTVEVLENRINT 79 
25027235    2 APKYDNSDVSGWGFETRSIHAGQPVDsDTGSRNLPIHLTTAFVFDSAEHAKQRFALEDLGPVYTRLTNPTVEAVENRINN 81 
237786134   2 TTKYDNSNADQWGFKTRAIHAGQPVDsETSSRNLPIYLTSSYVFDSAEHAKQRFGLEDEGPIYSRLTNPTVAAVENRLAS 81 
227832341   2 STKYDNSEVNEWSFATRALHAGQNLDgSTNARNVPIYQTTSYVFNDAEHAANRFNLSDAGPIYTRLTNPTQDALEERLAS 81 
68536784   80 LEGGVHAVAFASGMAAETAAILNLAGAGDHIVASPRLYGGTETLLQHTLPKLGIETTFVENPDDPESWQAAVRPNTKAFF 159
38233237   82 LEGGVHAVLFASGMAAETAAILNIARAGSHIVSSPRIYGGTETLFAVTLARLGIETTFVENPDDPASWEAAVQDNTVALY 161
62389543   81 LEGGVHAVAFSSGQAATTNAILNLAGAGDHIVTSPRLYGGTETLFLITLNRLGIDVSFVENPDDPESWQAAVQPNTKAFF 160
19551884   81 LEGGVHAVAFSSGQAATTNAILNLAGAGDHIVTSPRLYGGTETLFLITLNRLGIDVSFVENPDDPESWQAAVQPNTKAFF 160
145294828  81 LEGGVHAVAFSSGQAATTNAILNLAGAGDHIVTSPRLYGGTETLFLITLNRLGIDVSFVENPDDPESWQAAVQPNTKAFF 160
172040103  80 LEGGVHAVAFGSGMAAITAAFLNVANSGDHIVASPRLYGGTETLLLVTLPRLGITTTFVENPDDPQSWQDAVQDNTVAFF 159
25027235   82 LEGGAHTVFFASGQAATTAAILNLGGAGSHVVTSPRLYGGTETLFLVTLKRLGIEFTFVENPDDPESWQAAVRDNTIAFF 161
237786134  82 LEGGTHAVLFASGQAAETAAFLNIARSGSHIVSSPRLYGGTETLLAHTFRRLGIEVTFVEDPDDPQSWDAAAKDNTVAFY 161
227832341  82 LEGGVAAVAFASGQAAETAAILNLASAGDHIVTSPRLYGGTSTLFTVTLKRLGIDVTLVENPDDPASWQDAVQPNTKAFY 161
68536784  160 AETFANPQADVLNIPAVAEVAHANQVPLIVDNTLATAALVRPLELGADVVVASLTKFYTGNGSGLGGIIVDGGSFDWSVE 239
38233237  162 GETFANPQADVLDIPAIAEVAHKHQVPLIVDNTLATAALVRPLELGADVVVASLTKFYTGNGSGLGGVLIDGGNFDWTVT 241
62389543  161 GETFANPQADVLDIPAVAEVAHRNSVPLIIDNTIATAALVRPLELGADVVVASLTKFYTGNGSGLGGVLIDGGKFDWTVE 240
19551884  161 GETFANPQADVLDIPAVAEVAHRNSVPLIIDNTIATAALVRPLELGADVVVASLTKFYTGNGSGLGGVLIDGGKFDWTVE 240
145294828 161 GETFANPQADVLDIPAVAEVAHRNSVPLIIDNTIATAALVRPLELGADVVVASLTKFYTGNGSGLGGVLIDGGKFDWTVE 240
172040103 160 GETFANPQADVLDIPEISKVAHANKVPLIIDNTLATAALVKPLELGADVSVSSLTKFYTGNGSSIGGILVDGGKFDWTQE 239
25027235  162 GETFANPQADVLDIPAVSEVAHRNQVPLIVDNTIATAALVRPIELGADIVVASLTKFYTGNGSALGGALVDGGKFDWTVE 241
237786134 162 GETFANPQADILDIPAIAEVAHEHSVPLIVDNTVATAAAVRPLELGADVVVASLTKFYTGNGSGLGGVLIDGGKFDWTVE 241
227832341 162 GETFGNPVADVLDIPAIAEVAHKNQVPLIVDNTIATGALARPLELGADIVVVSTTKFYTGNGSAIGGAIIDGGSFDWTVE 241
68536784  240 RDGQPVFPGFVNPDPAYHGLKYVDLAPAAFGMKLRAGIIRDTGATLSPFNAWVVAQGLDTLTLRIAKHNENAKAVAEFLA 319
38233237  242 RNGEPIFPDFVTPDPAYHGLKYSDLGAPAFGLKARVGLLRDTGAAPSPLNAWITAQGLDTLSLRVQRHNENALAVAQFLA 321
62389543  241 KDGKPVFPYFVTPDAAYHGLKYADLGAPAFGLKVRVGLLRDTGSTLSAFNAWAAVQGIDTLSLRLERHNENAIKVAEFLN 320
19551884  241 KDGKPVFPYFVTPDAAYHGLKYADLGAPAFGLKVRVGLLRDTGSTLSAFNAWAAVQGIDTLSLRLERHNENAIKVAEFLN 320
145294828 241 KDGKPVFPYFVTPDAAYHGLKYADLGAPAFGLKVRVGLLRDTGSTLSAFNAWAAVQGIDTLSLRLERHNENAIKVAEFLN 320
172040103 240 RNGKPVFPGFVTPDPAYHGLKYADLGEPAFGLRARAGLLRDTGASLSPFNAWLAIQGLDTLNLRVKQHNENAKQVAEFLD 319
25027235  242 RDGKPVFPDFVTPDPAYHGLKYADLGAPAFGLKARVGLLRDTGAAPSPFNAWVTNQGLDTLSLRLERHNENAIKVAEFLN 321
237786134 242 RDGKPLFPDFVEPDPAYHGLKYADLGNVAFGLKARAGLLRDTGATPSPFNAWVTAQGLDTLSLRIAKHNENAQKVAEYLE 321
227832341 242 RDGEPVFPYFVTPDKAYHGLKYADLGAPAFAIKARAGLLRDTGAAISPFNAWLTLNGIETLQLRVEKHNANAQAVAEYLE 321
68536784  320 EQPQVATVNYAGLPTSPWFKVKEELGLEYTGSVLSFDLKvddptseEAKEKAWAFIDALQLHSDLANVGDVRSLVVHPAT 399
38233237  322 NHEKVAKVNYAGLPDSPWYPVKEKLGFDYTGSVLSFDVK-------GGKNEAWRFIDALKLHSNLANVGDVRSLVVHPAT 394
62389543  321 NHEKVEKVNFAGLKDSPWYATKEKLGLKYTGSVLTFEIK-------GGKDEAWAFIDALKLHSNLANIGDVRSLVVHPAT 393
19551884  321 NHEKVEKVNFAGLKDSPWYATKEKLGLKYTGSVLTFEIK-------GGKDEAWAFIDALKLHSNLANIGDVRSLVVHPAT 393
145294828 321 NHEKVEKVNFAGLKDSPWYATKEKLGLKYTGSVLTFEIK-------GGKDEAWAFIDALKLHSNLANIGDVRSLVVHPAT 393
172040103 320 KHPKVASVAYAGLESSPWNKVKEKLGLEYTGSVLAFDLAtg---daDPREAAWKFIDSLKLHSDLANVGDVRSLVVHPAT 396
25027235  322 NHEKVTKVHFAGLPDSPWYATKEKLGLKYTGSVLTFELA-------GGKDEAWAFIDALKLHSNLANIGDVRSLVVHPAT 394
237786134 322 SNPKVTKVNFPGLKSSPWYSVKEKLGLKYPGSVFSFDID-------GGRDTAWKFIDALKLHSDLANVGDVRSLVVHPAS 394
227832341 322 SHAKVTTVNYAGLDSSPYKATKEKLGYAYTGSVLSFDID-------GGREEAWAFIDALQLHSNLANIGDTRSLVVHPAT 394
68536784  400 TTHSQSDAHGLARAGVSHATVRLSVGIEDITDIINDLKLGFAAI 443
38233237  395 TTHSQSEESALLAAGINQATIRLSVGIESIDDIIADLTAGFDAI 438
62389543  394 TTHSQSDEAGLARAGVTQSTVRLSVGIETIDDIIADLEGGFAAI 437
19551884  394 TTHSQSDEAGLARAGVTQSTVRLSVGIETIDDIIADLEGGFAAI 437
145294828 394 TTHSQSDEAGLARAGVTQSTVRLSVGIETIDDIIADLEGGFAAI 437
172040103 397 TTHSQSTEENLRNAGISQATVRLSVGIEDVRDIIADLDQGFEQI 440
25027235  395 TTHSQSDEAGLARAGITQGTVRLSVGIENVEDIIADLERGFAAI 438
237786134 395 TTHSQSDEPALRAAGINESTIRLSVGIEDIDDIINDLKQAFEQI 438
227832341 395 TTHSQSDEAALKAAGITQATVRLSVGIEDVKDIIADLERGFAAI 438
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap