Conserved Protein Domain Family
PRK05529

?
PRK05529: PRK05529 
cell division protein FtsQ; Provisional
Statistics
?
PSSM-Id: 135428
View PSSM: PRK05529
Aligned: 5 rows
Threshold Bit Score: 304.151
Threshold Setting Gi: 50955147
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
50955147   34 LPSNREIGKALRAARKERRLLERaeVRRFTRRSRRRKQLWTAAAavggaLVLGVVLVGFSPLLALKNIEVTGTERLDPQA 113
28493197    1 MTVIDNAYQNFLYCRKQRKDYER--VCKIRTKIIRRFILLACAV-----FLLFCMLSAYSPVMSLRSIRVAGNMQVKTDD 73 
28572688    1 MTVVDNAYQNFLYCRKQRKDYER--VCKIRTKIIRRFILLACAV-----FLLFCMLSAYSPVMSLRSIRVAGNMQVKTDD 73 
148273038   1 -------------------------MRRFTQRARRRRAGLLGALgavltLAIVVGIAVYSPLLALRTVEVEGADRVSPSS 55 
170781770  19 ATGDAEARRQLRRARRERQRYERqeVRRFTQRTRRRRAGLLGALgavltLAIVVGIAVYSPLLALRTVEVEGADRVSPQS 98 
50955147  114 IRQKLGDQLGRPLPLLDQAAISSDLAAFPLIRSYSVESHPPDTIVVRVVERQPIGAIQQGSAFTVVDAAKVPISSTQARP 193
28493197   74 IVAALRGEFNKPLAFVDPETVRKKLAKFKLLKEVTVEAKPPGAILVRVSERVPLAFLERPDGFHVLDEDGVSLKVTQSPP 153
28572688   74 IVAALRGEFNKPLAFVDPETVRKKLAKFKLLKEVTVEAKPPGAILVRVSERVPLAFLERPDGFHVLDEDGVSLKVTQSPP 153
148273038  56 IQAALSDQVGTPLPLVDLDRVGDELRAFPLIRSYSTESRPPSTLVIRIVERTPVAVIQSGAGFDLVDAAGITIERTTARP 135
170781770  99 IQAALSDQVGTPLPLVDLDRVGDELRAFPLIRSYSTESRPPSTLVIRIVERTPVAVIQSGAGFDLVDPAGITIERATARP 178
50955147  194 EGMPLIAAsgpaADADADSGFAAAAGVLSALPADVRAQVDTITAKTKDDVLFTLRGSGATVVWGSAEDSALKAADLAALL 273
28493197  154 LGMVRIDV----KDGNQEQLVASLGWVIANIPDALKKRVDLISAETPSGINLKLDNSTKTVFWGSFQNSKLKAKVLEKLL 229
28572688  154 LGMVRIDV----KDGNQEQLVASLGWVIANIPDALKKRVDLISAETPSGINLKLDNSTKTVFWGSFQNSKLKAKVLEKLL 229
148273038 136 DGYPLIDLp---SADFSSPRFQAAAAVLVALPADFLPQVDSIQANTTDDVMLTLR-SGKKVLWGSGERSVDKAQVLQALV 211
170781770 179 DGYPLIDLp---SADFSSPRFQAAAAVLVALPADFLPQVDSIQANTTDDVMLTLR-SGKKVLWGSGERSVDKAQVLQALV 254
50955147  274 KSVPGNSRYDVSSPHSVTTG 293
28493197  230 SIPGHYSSFNVSAPEAPAVS 249
28572688  230 SIPGHYSSFNVSAPEAPAVS 249
148273038 212 KARGDVGSYDVSAPDAPVAG 231
170781770 255 KARGDVGSYDVSAPDAPVAG 274
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap