Conserved Protein Domain Family
PRK04654

?
PRK04654: PRK04654 
sec-independent translocase; Provisional
Statistics
?
PSSM-Id: 135173
View PSSM: PRK04654
Aligned: 8 rows
Threshold Bit Score: 228.158
Threshold Setting Gi: 188574638
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
58584030    1 MFDIGVGELTLIAVVALVVLGPERLPKAARFAGLWVRRARMQWDSVKQELERELEAEELKRSLQDVQASLREAEDQLRNK 80 
21233514    1 MFDIGFSELALIAVVALVVLGPERLPKAARFAGLWVRRARMQWDSVKQELERELEAEELKRSLQDVQASLREAEGQLRNT 80 
66770479    1 MFDIGFSELALIAVVALVVLGPERLPKAARFAGLWVRRARMQWDSVKQELERELEAEELKRSLQDVQASLREAEGQLRNT 80 
188993691   1 MFDIGFSELALIAVVALVVLGPERLPKAARFAGLWVRRARMQWDSVKQELERELEAEELKRSLQDVQASLREAEGQLRNT 80 
84625808    1 MFDIGVGELTLIAVVALVVLGPERLPKAARFAGLWVRRARMQWDSVKQELERELEAEELKRSLQDVQASLREAEDQLRNK 80 
188574638   1 -----------------------------------MRRARMQWDSVKQELERELEAEELKRSLQDVQASLREAEDQLRNK 45 
21244934    1 MFDIGVGELTLIAVVALVVLGPERLPKAARFAGLWVRRARMQWDSVKQELERELEAEELKRSLQDVQASLREAEDQLRNK 80 
78049876    1 MFDIGVGELTLIAVVALVVLGPERLPKAARFAGLWVRRARMQWDSVKQELERELEAEELKRSLQDVQASLREAEDQLRNT 80 
58584030   81 QQQVEQGARA-------LHDDVSRDIDIRSSATPVATPLELahadlsasaHVDAAAGAAAGAGPAPAPAPAPaAPVIAQA 153
21233514   81 QQQVEDGARGlhdqareLHDEVGRDIDIRTSATPLAAPLEL---------QADAPVVLEPGSAQPHTPVPAP-APVVAQA 150
66770479   81 QQQVEDGARGlhdqareLHDEVGRDIDIRTSATPLAAPLEL---------QADAPVVLEPGSAQPHTPVPAP-APVVAQA 150
188993691  81 QQQVEDGARGlhdqareLHDEVGRDIDIRTSATPLAAPLEL---------QADAPVVLEPGSAQPHTPVPAP-APVVAQA 150
84625808   81 QQQVEQGARA-------LHDDVSRDIDIRSSATPVATPLELahadlsasaHVDAAAGAAAGAGPAPAPA----APVIAQA 149
188574638  46 QQQVEQGARA-------LHDDVSRDIDIRSSATPVATPLELahadlsasaHVDAAAGAAAGAGPAPAPAPA--APVIAQA 116
21244934   81 QQQVEQGARA-------LHDDVSRDIDIRASATPVATPLELahadwsaspDVDTAAGATDAAGAAHT------APVIAQA 147
78049876   81 QQQVEQGART-------LHDDVSRDIDIRASATPVATPLELahadlsaspDVDATAGVTDAAGAAHT------APVIAQA 147
58584030  154 QPIAPAPHQTLVPAPHDTIVPAPHAAHLTSAPAPPVTVAPvdagtsasptpseptkiQEKQP 215
21233514  151 QPMAPAPKQTLVPAPHGSLTSTQVTTHAPTASATASSTSP-----------------QEKTP 195
66770479  151 QPMAPAPKQTLVPAPHGSLTSTQVTTHAPTASATASSTSP-----------------QEKTP 195
188993691 151 QPMAPAPKQTLVPAPHGSLTSTPVTTHAPTASVTASSTSP-----------------QEKTP 195
84625808  150 QPIAPAPHQTLVPAPHDTIVPAPHAAHLTSAPAPPVTVAPvdagtsasptpseptkiQEKQP 211
188574638 117 QPIAPAPHQTLVPAPHDTIVPAPHAAHLSSAPAPPVTVAPvdagtsasptpseptkiQEKQP 178
21244934  148 QPIAPAPHQTLVPAPHDAIVPAPHAAHLASAP-EPVAVVPvdagtpaasmpsapakiQEKQP 208
78049876  148 QPIAPAPHQTLVPAPHDTIVPAPHAAHLASAP-EPVAVAPvdagtpaawtpsapaklQEKQP 208
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap