Conserved Protein Domain Family
PRK04425

?
PRK04425: PRK04425 
septum formation protein Maf
Statistics
?
PSSM-Id: 167814
View PSSM: PRK04425
Aligned: 8 rows
Threshold Bit Score: 337.219
Threshold Setting Gi: 226939505
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
59802468    1 MGLELPLVLGTSSVFRREQMERLGIAFQAASPDFDETPMLGESAPQTALRLAEGKARSLTGRFPGALIVGADQVAWCDGR 80 
194100141  19 MGLELPLVLGTSSVFRREQMERLGIAFQAASPDFDETPMLGESAPQTALRLAEGKARSLTGRFPGALIVGADQVAWCDGR 98 
15677740    1 MGLELPLILGTSSVFRREQMERLGIAFQAASPDFDETPMLGESAPQTALRLAEGKARSLTGRFPEALIVGADQVAWCDGR 80 
218767517   1 MGLELPLILGTSSVFRREQMERLGIAFQAASPDFDETPMLGESAPQTALRLAEGKARSLAGRFPEALIVGADQVAWCDGR 80 
121634183   1 MGLELPLILGTSSVFRREQMERLGIAFQAASPDFDETPMLGESAPQTALRLAEGKARSLTGRFPEALIVGADQVAWCDGR 80 
161869306   1 MGLELPLILGTSSVFRREQMERLGIAFQAASPDFDETPMLGESAPQTALRLAEGKARSLTGRFPEALIVGADQVAWCDGR 80 
34498875    1 ----MHIVLASTSRYRQEIIARLGLPFCAEPPVCDETPLPGETALETAVRLARVKAQSLAGKHPEALIIGSDQVALLDDK 76 
226939505   1 ----MRLVLASTSRFRREMLSRLGLPFEALAPVCDETPLPGESALDTACRLARIKARSLGERCPDALIIGSDQVALLDGE 76 
59802468   81 QWGKPMNLANAQKMLMHLSGREIEFYSAVVLLNTVTGRMHRHIDKTVVVMRQLDELHILRYLEREPDAVYCSCAAKSEGL 160
194100141  99 QWGKPMNLANAQKMLMHLSGREIEFYSAVVLLNTVTGRMHRHIDKTVVVMRQLDELHILRYLEREPDAVYCSCAAKSEGL 178
15677740   81 QWGKPMNLANAQKMLMHLSGREIEFYSAIVLLNTVTGRMRRHIDKTVVVMRQLDELHILRYLEREPDAVYCSCALKSEDL 160
218767517  81 QWGKPMNLANAQKMLMHLSGREIEFYSAVVLLNTVTGRMQRHIDKTVVVMRKLDELHILRYLEREPDAVYCSCALKSEAL 160
121634183  81 QWGKPMNLANAQKMLMHLSGREIEFYSAIVLLNTVTGRMRRHIDKTVVVMRQLDELHILRYLEREPDAVYCSCALKSEDL 160
161869306  81 QWGKPMNLANAQKMLMHLSGREIEFYSAVVLLNTVTGRMQRHIDKTVVVMRKLDELHILRYLEREPDAVYCSCALKSEGL 160
34498875   77 QIGKPGGFEQGVEMLKWMSGRTVVFHSALALYNTASGRLQECVGITRVTLRRLTEAQIRNYLTREPDALHCAGSAKSEGL 156
226939505  77 QLGKPGSVPAAIEMLRRTRGRELVFHTALALYDARCDVLRERADITTVRMRNLTDGQIAAYLEREPDAIHCAGGCMSEKL 156
59802468  161 GALLIERIESTDPNALIGLPVFRLVDFLKNEGVDVL 196
194100141 179 GALLIERIESTDPNALIGLPVFRLVDFLKNEGVDVL 214
15677740  161 GALLIERIESTDPNALIGLPVFRLVDFLKNEGVEVL 196
218767517 161 GALLIERIESTDPNALIGLPVFRLVDFLKNEGVDVL 196
121634183 161 GALLIERIESTDPNALIGLPVFRLVDFLKNEGVEVL 196
161869306 161 GALLIERIESSDPNALIGLPVFRLVDFLKNEGVEVL 196
34498875  157 GGALLEKVESDDPNALIGVPLFQLITMLGNEGVEVL 192
226939505 157 GGALIARIDSTDPNALIGLPLFDLVDLLLEAGVEVL 192
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap