Conserved Protein Domain Family
murD

?
PRK04308: murD 
UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
Statistics
?
PSSM-Id: 167786
View PSSM: PRK04308
Aligned: 9 rows
Threshold Bit Score: 687.003
Threshold Setting Gi: 226941971
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
34499800    1 MDYANRHVTVVGLGGSGLAAARYLAAHGARVRVADANPSAERLAELERCLPGVEVMVGAFDDATFAGAELLVVSPGVPLA 80 
59801871    1 MTFQNKKILVAGLGGTGISMIAYLRKNGAEVAAYDAELKAERVAQIGKMFDGLVFYTGRLKDALDNGFDILALSPGISER 80 
194099349   1 MTFQNKKTLVAGLGGTGISMIAYLRKNGAEVAAYDAELKAERVAQIGKMFDGLVFYTGRLKDALDNGFDILALSPGISER 80 
254805548   1 MTFQNKKILVAGLGSTGISMIAYLRKNGAEVAAYDAELKPERVSQIGKMFDRLVFYTGRLKDALDNGFDILALSPGISER 80 
15676332    1 MTFQNKKILVAGLGGTGISMIAYLRKNGAEVAAYDAELKPERVSQIGKMFDGLVFYTGRLKDALDNGFDILALSPGISER 80 
218768812   1 MTFQNKKILVAGLGGTGISMIAYLRKNGAEVAAYDAELKPERVSQIGKMFDGLVFYTGRLKDALSNGFDILALSPGISER 80 
121635446   1 MTLENKKILVAGLGGTGISMIAYLRKNGAEVAAYDAELKPERVSQIGKMFDGLVFYTGRLKDALDNGFDILALSPGISER 80 
161870654   1 MTFQNKKILVAGLGGTGISMIAYLRKNGVEVAAYDAELKPERVAQIGKMFDGLVFYTGRLKDALDNGFDILALSPGISER 80 
226941971   5 LGFANKTVCVVGLGGSGLAAARFLAPRVGRLVVADSREVPPNAGQLAGVAAGAELRAGAFSAATFAGCDVLVLSPGVPLA 84 
34499800   81 NPAIAAFRRAGGEVVGDIEILARAIQGDGSKVIAITGSNGKSTVTSLVGHLCEAAGLDTVVAGNIGLAVLEALLAREqsG 160
59801871   81 QPDIEAFKQNGGRVLGDIELLADIVNRRGDKVIAITGSNGKTTVTSLVGYLCIKCGLDTVIAGNIGTPVLEAELQRE--G 158
194099349  81 QPDIEAFKQNGGRVLGDIELLADIVNRRGDKVIAITGSNGKTTVTSLVGYLCIKCGLDTVIAGNIGTPVLEAELQRE--G 158
254805548  81 QPDIEAFKQNGGRVLGDIELLADIVNRRGDKVIAITGSNGKTTVTSLVGYLCIKCGLDTVIAGNIGTPVLEAEWQRE--G 158
15676332   81 QPDIEAFKQNGGRVLGDIELLADIVNRRDDKVIAITGSNGKTTVTSLVGYLCIKCGLDTVIAGNIGTPVLEAEWQRE--G 158
218768812  81 QPDIEAFKRNGGRVLGDIELLADIVNRRGDKVIAITGSNGKTTVTSLVGYLCIKCGLDTVIAGNIGAPVLEAELQRE--G 158
121635446  81 QPDIEAFKQNGGRVLGDIELLADIVNRRGDKVIAITGSNGKTTVTSLVGYLCIKCGLDTVIAGNIGTPVLEAEWQRE--G 158
161870654  81 QPDIEAFKQNGGRVLGDIELLADIVNRRGDKVIAITGSNGKTTVTSLVGYLCIKCGLDTVIAGNIGTPVLEAEWQRE--G 158
226941971  85 TPAVAAF---AGEVIGDVEVFARAIAPLAIPVIAITGSNGKTTVTSLAGHLVAACGRRGVVAGNIGLAVLDALADIEasG 161
34499800  161 KRPDVWVLELSSFQLESTFSLAADAATVLNISEDHLDRYADLLDYAHAKTRVFNGKGVQVLNKDDALVRAMVRPGHPVKW 240
59801871  159 KKADVWVLELSSFQLENTESLRPTAATVMNISEDHLDRYDDLLDYAHTKAEIFRGDGVQVLNADDVFCRAMKRAGREVKR 238
194099349 159 KKADVWVLELSSFQLENTESLRPTAATVMNISEDHLDRYDDLLDYAHTKAKIFRGDGVQVLNADDVFCRAMKRAGREVKR 238
254805548 159 KKADVWVLELSSFQLENTESLRPTAATVLNISEDHLDRYDDLLDYAHTKAKIFRGDGVQVLNADDAFCRAMKRAGREVKW 238
15676332  159 KKADVWVLELSSFQLENTESLRPTAATVLNISEDHLDRYDDLLDYAHTKAKIFRGDGVQVLNADDAFCRAMKRAGREVKW 238
218768812 159 KKADVWVLELSSFQLENTESLRPTAATVLNISEDHLDRYDDLLDYAHTKAKIFRGDGVQVLNADDAFCRAMKRAGREVKW 238
121635446 159 KKADVWVLELSSFQLENTESLRPTAATVLNISEDHLDRYDDLLDYAHTKAKIFRGDGVQVLNADDAFCRAMKRAGREVKW 238
161870654 159 KKADVWVLELSSFQLENTESLRPTAATVLNISEDHLDRYDDLLDYAHTKDKIFRGDGVQVLNADDAFCRAMKRAGREVKW 238
226941971 162 ELPECFVLELSSFQLETTTSLNAIAATTLNISEDHLDRYRDLLAYADSKAAVFNGGGVQVLNRDDLFVRAMARPQRRHVW 241
34499800  241 FSLNGA-ADYALARNGGYw-LKVDGEKVFDCADMQLQGLHNAANALAALGLCQGIGLPLEKLLDGLKTFRGLAHRVELVD 318
59801871  239 FSLEHE-ADFWLERGTGC--LKQGNEDLISTQDIPLQGLHNAANVMAAVALCEAVGLPREALLEHVKTFQGLPHRVEKIG 315
194099349 239 FSLEHE-ADFWLERGTGC--LKQGNEDLISTQDIPLQGLHNAANVMAAVALCEAVGLPREALLEHVKTFQGLPHRVEKIG 315
254805548 239 FSLEHE-ADFWLARETGR--LKQGNEDLIATQDIPLQGLHNAANVMAAVALCEAIGLSRNELLEHVKTFQGLPHRVEKIG 315
15676332  239 FSLEHE-ADFWLERETGR--LKQGNEDLIVTQDIPLQGLHNAANVMAAVALCEAIGLSREALLEHVKTFQGLPHRVEKIG 315
218768812 239 FSLEYE-ADFWLERETGR--LKQGNEDLIATQDIPLQGLHNATNVMAAVALCEAVGLPREALLEHVKTFQGLPHRVEKIG 315
121635446 239 FSLEHE-ADFWLERETGR--LKQGNEDLIATKDIPLQGLHNAANVMAAVALCEAVGLPREALLEHVKTFQGLPHRVEKIG 315
161870654 239 FSLEYE-ADFWLERETGR--LKQGNEDLIATQDIPLQGLHNATNVMAAVALCEAVGLPREALLEHVKTFQGLPHRVEKIG 315
226941971 242 FSLEDAgADYALAERDGRhwLCAGGEALLPFDAMQLVGLHNAANALAALALCEAAGLPRAGLLAGLTTFKGLAHRVEHVL 321
34499800  319 EFDGIAFIDDSKGTNVGATEAALNGMTRQVVLIAGGDGKGQDFAPLKPACQRIARAVLLIGRDAGRIEAALEDSGLALER 398
59801871  316 EKNGVVFIDDSKGTNVGATAAAIAGLQNPLFVILGGMGKGQDFTPLRDALKDKAKGVFLIGVDAPQIRRDLDGCGLNLTD 395
194099349 316 EKNGVVFIDDSKGTNVGATAAAIAGLQNPLFVILGGMGKGQDFTPLRDALKDKAKGVFLIGVDAPQIRRDLDGCGLNLTD 395
254805548 316 EKNGVVFIDDSKGTNVGATAAAIAGLQNPLFVILGGMGKGQDFTPLRDALAGKAKGVFLIGIDAPQIRRDLDGCDLNMTD 395
15676332  316 EKNGVVFIDDSKGTNVGATAAAIAGLQNPLFVILGGMGKGQDFTPLRDALVGKAKGVFLIGVDAPQIRRDLDGCGLNMTD 395
218768812 316 EKNGVVFIDDSKGTNVGATAAAIAGLQNPLFVILGGMGKGQDFTPLRDALAGKAKGVFLIGVDAPQIRRDLDGCDLNMTD 395
121635446 316 KKNGVVFIDDSKGTNVGATAAAIAGLQNPLFVILGGMGKGQDFTPLRDALAGKAKGVFLIGVDAPQIRRDLDGCGLNMTD 395
161870654 316 EKNGVVFIDDSKGTNVGATAAAIAGLQNPLFVILGGMGKGQDFTPLRDALAGKAKGVFLIGVDALQIRRDLDGCDLNMTD 395
226941971 322 THEGVDFIDDSKGTNVGATEAALKGMTRPVVLIAGGDGKGQDFSPLAPALARIGRAVLLIGRDAPVVRQALAGLALPLID 401
34499800  399 CDTLEEATRRAAALARPGDVVLLSPACASLDMFKNYAHRAQVFIDTVAAV 448
59801871  396 CVTLEEAVQTAYAQAEAGDIVLLSPACASFDMFKGYAHRSEVFIEAFKAL 445
194099349 396 CVTLEEAVQTAYAQAEAGDIVLLSPACASFDMFKGYAHRSEVFIEAFKAL 445
254805548 396 CATLEEAVQKAYAQAEAGDIVLLSPACASFDMFKGYAHRSEVFIGAFKAL 445
15676332  396 CATLGEAVQTAYAQAEAGDIVLLSPACASFDMFKGYAHRSEVFIEAFKAL 445
218768812 396 CATLEEAVQKAYAQAEAGDIVLLSPACASFDMFKGYAHRSEVFIGAFKAL 445
121635446 396 CATLEEAVQTAYAQAEACDIVLLSPACASFDMFKGYAHRSEVFIEAFKAL 445
161870654 396 CATLEEAVQKAYAQAEAGDIVLLSPACASFDMFKGYAHRSEVFIGAFKAL 445
226941971 402 CATLEEATRRGFELAQPGDVVLLSPACASFDMFRGYAHRAEVFIACAREL 451
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap