Conserved Protein Domain Family
PRK04128

?
PRK04128: PRK04128 
1-(5-phosphoribosyl)-5- ((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase
Statistics
?
PSSM-Id: 167709
View PSSM: PRK04128
Aligned: 6 rows
Threshold Bit Score: 338.67
Threshold Setting Gi: 48478405
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
160902483   6 NIRIIPAIDLMNKKAVRLYKGSKNEIKEYGDPIEIAKEFSKYVDLIHIVDLDGAFEGSVKNLDVVKQIIQKTGLKVELGG 85 
18978034    2 KFRIYPAIDIMDGKVVRLYKGKKDEVKVYGDPLKFAEKFSEYVDKIHIVDLDGAFSGKPQNLDIVEKIIRDVGVRVQIGG 81 
240103668   1 -MEIYPAIDLMGGKAVRLYKGKKNTVKVYGDPVEIAGRFAELVDKIHVVDLDGAFQGFPRNLDVVKGIIRETGLRVQFGG 79 
57640182    1 -MEVYPAIDLMKGRAVRLYRGRRESVKVYGDPVKIAQGFSELVDKIHVVDLDGAFEGRPRNLEVVERIIEETGLRVQVGG 79 
212224032   1 -MRIYPAIDLMGGKAVRLYRGQKEKVKVYGDPVEIASRFTELVDKIHVVDLDGAFTGKPQNLDVVKEIIEETGLKVQVGG 79 
48478405    1 MIDVYPAIDIYNGRAVFLENGRLERIKVYGDPVYYALRFQEYFDFLHVIDLNGAIENKRKNRDVIKNIIKEVKAKVQVGG 80 
160902483  86 GLRTFESIKDAYEIGVTYVIIGTAAFNLEFLEKVTSAFNNITISMDVENGTLKTKGWLENSQITLEDAFSIFKKYTNRFI 165
18978034   82 GFRDYESIKKAYDIGVENVIIGTKALDISFLERITSEFEGITVSLDSKGGKIFTKGWIEEESLLVEDAYKMLRKFVNRFV 161
240103668  80 GLRSYEAIERAYEIGVENAIIGTKAFDLDFLRKVTEDFEGITVSLDSKGGRIAVKGWLE-SGIPVREAYEMLKAYVNRFV 158
57640182   80 GFRTYEAVGRAYEVGVENVILGTKALDTAFLERLTDEFGGITVSLDVKDGRIAVKGWVEEGSIKVRDAFEILRNYVNRFV 159
212224032  80 GFRSYESIAKAYEIGAENVIIGTKAFDLEFLEKITDNFDGITVSLDARGGKIAVKGWLEESSLKVGEAYEMLREYVDRFI 159
48478405   81 GLRTLNDVIDVYDFGAYSAIIGTN-IDIEVDK-------NVTLSIDVYKDRVANRGWLNITDNDPVSFYKMLKNRFSRFI 152
160902483 166 YTDTNKDGT-LEGVSlNIKRFWQDEEIIYAGGVSKKEDLKKLENIGFDGAIIGKALYEGKINLQELRGEQ 234
18978034  162 YTVIDRDGT-LLGIE-KIKRFWGDEEFIYAGGVATPTDIIQLAEIGFSGVIIGKALYEGTISLEEALEVA 229
240103668 159 YTSVERDGT-LTGIE-EIERFWKNEEFIYAGGVSSAEDVVRLKRIGFSGVIVGKALYEGLVKLEDLLEVV 226
57640182  160 YTSIERDGT-LTGVD-EIGRFWGDEEFIYAGGVSSAEDIVRLAERGFSGVIVGKALYEGVVKLEDLLEVA 227
212224032 160 YTSIERDGT-LTGIE-SIERFWKDEEFIYAGGVSSVDDVLKLRRVGFSGAIVGKALYESEVSLKELLEVL 227
48478405  153 YTNIGSDGTnNSGIP---EKFWDNEYFIYAGGVSGINDVKKALKNGFSGIIIGRALYENRIDPGELKCLQ 219
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap