Conserved Protein Domain Family
PRK04021

?
PRK04021: PRK04021 
hypothetical protein; Reviewed
Statistics
?
PSSM-Id: 167678
View PSSM: PRK04021
Aligned: 7 rows
Threshold Bit Score: 128.387
Threshold Setting Gi: 33359419
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18978137    1 MLRETSEGVILSVIVAPNARETKIVGIDGTRGRVKVNVAAPPVKGKANKELMKFFKKLFGAEVVIVRGETSREKDLLIKG 80 
14520717    1 MLKEVREGVILRVIVKPNARENSIEGIDEWRGRIKVNIKAQPVKGKANRELIKFLSNLFGAEVEILKGETSREKDVLVRG 80 
33359419    4 VLKETKDGTIIQVIVRPNSKENKIEGVDNWKNRIRISIKAPPVKGEANKELIKFLSKILGAKVEIIRGETSREKDLLVKG 83 
242398935   1 MIKESKEGVILQIYVQPKANTNEIEGVDEWRGRLKVKIKAPPVEGKANKEVVKFFSKLLGAEASLIKGETSREKDLLIRG 80 
240103723  34 FLKETKDGTLLLVYVQPKAKKNEIEGIDEWRGRLKVKVKAPPVGGKANKELVKFLSKVLGAEVELVRGETSREKDLLVR- 112
57640703    3 FIKETKEGVLIMIYVQPKAKKNAIEGVDGWRGRLKVRIAAPPVEGKANKEVVKFFSKLLGAEVNIVRGETSREKDLLVKG 82 
212223789   3 FIRETKDGAVILLYVQPKAKKNEIEGVDEWRGRLKVKIKAPPVEGKANKEVVRFFSKMLGTEVEIIRGGTSREKDLLVKG 82 
18978137   81 ITKKEVIEKLEL 92 
14520717   81 VNLEEVKRRLKL 92 
33359419   84 IKLEEVKKRLKL 95 
242398935  81 ISIEEVKKKLKI 92 
240103723 113 MSAEDVKKRLGL 124
57640703   83 LSVEEVRKKLGV 94 
212223789  83 FSSKEVLKKLGL 94 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap