Conserved Protein Domain Family
argD

?
PRK04013: argD 
acetylornithine/acetyl-lysine aminotransferase; Provisional
Statistics
?
PSSM-Id: 101376
View PSSM: PRK04013
Aligned: 4 rows
Threshold Bit Score: 707.457
Threshold Setting Gi: 14520659
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18978057   1 MSLYRKRLRLVKGEGIYVWDSQGKKYIDLIAGIGVNVLGHNHPEWVSELQEQLEKLVVAGPMFDHEEKYEMLEELEKFVT 80 
14520659   1 MSLYRKRLKIVRGEGIYVWDSEGKRYLDLIAGIGVAILGHNHPKWVEEVGNQLNKLVVAGPMFEHEEKEEMLEELSRWVN 80 
14591479   1 MSLYRKRLKIIKGEGIYVWDDQGRRYVDLIAGIGVAILGHNHPEWVEGIREQLNKLVIAGPMFNHEEKEEMLEELSKFVN 80 
57640210   1 MPLYRKRLRLVRGEGVYVWDEKGRRYLDLIAGIGVNVLGHAHPEWVLDMSRQLEKIVVAGPMFEHDEREEMLEELSHWVD 80 
18978057  81 YEYVYIGNSGTEAVEAALKFARLYTGRKEIIAMTNAFHGRTMGALSATWKPKYREDFKPLVPGFKHIPFNDVEAAKEAIT 160
14520659  81 FEYVYMGNSGTEAVEAALKFARLYTGRKEIIAMTNAFHGRTMGALSATWKSKYKKDFEPLVPGFKHIPFNDVEAAKEAIT 160
14591479  81 FEYLYMGNSGTEAVEAALKFARLYTGRKEIIAMVNAFHGRTMGALSATWKPKYKKDFEPLVPGFKHIPFNDVEAAKEAIS 160
57640210  81 YEYVYMGNSGTEAVEAAIKFARLATGRSEIVAMTNAFHGRTLGSLSATWKKKYREGFGPLVPGFKHIPFNNVEAAKEAIT 160
18978057 161 TETAAVIFEPIQGEGGVVPANEEFVKTLRDLTEDKGALLIADEVQSGLRTGKFLAIEHYKVEPDIVTMGKGIGNGVPVSL 240
14520659 161 RTTAAVIFEPIQGESGIIPAKEEFVKTLRDLTEDVGALLIADEVQSGLRTGKFLAVEHYKVEPDIVTLGKGIGNGVPVSL 240
14591479 161 KETAAVIVEPIQGESGVIPAKKEFMKALRDLTEDVGALLIVDEVQTGLRTGKFLAVEHYKIEPDIVTMGKGIGNGIPVGL 240
57640210 161 KETAAVIFEPIQGEGGIVPADEEFVKTLRDLTEDVGALLIADEVQSGLRTGKFLAIEHYGVRPDIVTMGKGIGNGFPVSL 240
18978057 241 TLTNFDVERGKHGSTFGGNPLACKAVAVTLRILRREKLIEKAAEKFIEIKGENVVLTRGKGLMIGIVMKKPVAKVVEELQ 320
14520659 241 TLTNFDVERGKHGSTFGGNPLACKAVAVTLRILRKERLVEKASEKFIKVKGKDVVTTRGRGLMIGIVLKKPVGRYVEELQ 320
14591479 241 TLTNFDVERGKHGSTFGGNPLACKAVAITLRILRKERLIEKAKNKFIQIDADEVVTTRGKGLMIGIVFKTTIGKYVEELQ 320
57640210 241 TLTDLEIPRGKHGSTFGGNPLACRAVATTLRILRRDRLVEKAGEKFMEFSGERVVKTRGRGLMIGIVLRRPAGNYVKALQ 320
18978057 321 NRGYLVHTAGQRVIRLLPPLIISKDEINQAKSAIEGVINDIYGR 364
14520659 321 NEGYLVHTSGQRVIRLLPPLIISKEKMMEVKSAIEGVINGDTEG 364
14591479 321 NRGYLVHTAGQRVMRLLPPLIISKETMQDVKLAIEGVINDLRGG 364
57640210 321 ERGILVNTAGNRVIRLLPPLIIEGDTLEEARKEIEGVLNDIL-- 362
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap