Conserved Protein Domain Family
PRK03967

?
PRK03967: PRK03967 
histidinol-phosphate transaminase
Statistics
?
PSSM-Id: 167650
View PSSM: PRK03967
Aligned: 6 rows
Threshold Bit Score: 469.218
Threshold Setting Gi: 48478369
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18978037    1 MIWEEILNFEPYRAVEGNYRIWLDKNESPYDLPPQLKEEILEELKRIEFNRYPHITSDPLREALAEFYG---------LK 71 
240103671   1 MISELVKSFQPYRVVEGNYRIRLDKNENPYDLPGEVKEEIFEELREVSFNRYPHITSMPAREAIADFYG---------VS 71 
57640185    1 MIRNEVKAFKPYRVIEGNYRIWLDKNESPYDLPEELKEEIFEELKSVPFNRYPHITSMPAREAIGEFYG---------LP 71 
212224035   2 RIRPLVKSFQPYKVLEGDYRIWLDKNENPFDLSPEIKEEIFEELKRVPFNRYPHITADPLRERIAEFLG---------ID 72 
160902486   5 PILESFEEYKPSNTYINDGFIDLSKNENPFDLSLDLKKIFFQKITETNINRYPELTADNIRQKIATFLNsyfsrynidLD 84 
48478369    1 -------------------MIFLDKNENPFDVPEKIKQDFIEFVKRAGFNRYPERGLPDLLNAISDLTG---------YD 52 
18978037   72 KENIAVGNGSDELINYLVKMFKGKYIVVTSPTFGMYSFFAKLHGIPVKDIPLKEDFTIDGERIAEEGKAASAIFIASPNN 151
240103671  72 PDNVAVGNGSDELLSYLVRLFEGNHIVITPPTFGMYSFYAKLNGVPVVEVPLREDFTLDGEAVAEKAKNARVVFIASPNN 151
57640185   72 AENVAVGKGGDELIGYLVRLFEGDYIVTTPPTFGMYSFYARLNGIPVIEVPLREDFTIDGDTIAEKAKKASAVFIASPNN 151
212224035  73 KENIIVGNGSDELISLILKLFDGDHIVISSPTFGMYGFFAKFEGINLIDVPLDENFRL--QNVEEYAENARALFICSPNN 150
160902486  85 MNNIVVGNGSDETISYLVKIFSGKDVIICPPTFEMYEFYSVLNGFSVKKIPLNTNYEIK-DIDKAVDDQTSMIFICSPNN 163
48478369   53 ADNLIAGNGSDELLERIIS--NSESILISTPTFEMYSFYANNYNKRLINVPLKNDFNIDPERIVE--SDAETVIICSPNN 128
18978037  152 PTGNSQPENEVLKVLDSGRVVILDEAYSEFSGKSFIPKISEYENLVILRTFSKAFGLAGIRCGYMIANEKIIDALYRILP 231
240103671 152 PTGNLQPEEEIIRVLETRRPVVLDEAYAEFVGKSLWRLIEEYPNLVVLRTFSKAFGMAGIRAGYMLAGEEIVDALYRIKS 231
57640185  152 PTGNLQPVEEVLKVLETGKAVVVDEAYVEFAGKDLLGLLDEYPNLVLLRTFSKAFSLAGARVGYALASEEIIEALYRIKS 231
212224035 151 PTGNTQDREKIISVLETGAPVVLDEAYVEFAKGSNVDLISEYDNLIVLRTFSKAFGLAGVRVGYAVGSEEIIDHLHRIKP 230
160902486 164 PTGNLQPQKEILKALKTGVPVIVDEAYADFSKISMIQHLKDYPNLIILKTFSKAFGLAGIRAGILIANEEIVKQIMKIKS 243
48478369  129 PTGNLQNIDDIKYILDSGKNVVIDNAYYEFSGYDYKGLVDSYDNLILLRTFSKAFSMAGLRIGYGISKSSIIKDIKRKMP 208
18978037  232 PYNLNSLTMTVAIKMLEHYDIVKRRIKLIVKERERIRREFIEYSYPSEANFLLMKLD---------AYDYLLKKGIVVRK 302
240103671 232 PFSVGIMTMTAIRVALRHADLMEKTVRKIVEERERMRRKLGELAYPSDANFLLVRLN---------AYEELLKRGIVVRK 302
57640185  232 PFSVDIFAQAVVKVVLRHPGLFRERIREIVRERERVRRSLGELAYPSDANFLLVKAD---------AHSFLLERGIVVRK 302
212224035 231 PFTLDSISMKIAGLMLDHYDLVKRNIDYIIKERERIYRKFKDYAYPSEANFILMKLN---------AYEFLLEKGIVVRK 301
160902486 244 PYSFNVLTEKMVETIIENYNLILEKIDYIIEERNKLSKELGRVALKSDANFILLDFDkiegitakaVYNYFLENKMLLRR 323
48478369  209 PFYMNILSEGIVRLAVDNYKLIEDRINYIIKERSRVYNEISDMAFKSDANFLLLKKD---------LYDYMMKNGVMIRK 279
18978037  303 LSGRLEGHIRVTIGKKWENDELIKALKEFLEECRC 337
240103671 303 LSGRLEGHIRVTVGRRWENDAFLEAVEEIAGGESV 337
57640185  303 LSGRLKGHIRVTIGRR-ENDAFLKAMEEWKDVAGL 336
212224035 302 LGGRLTGHIRVTVGKREENDELIGALKEFMEGRG- 335
160902486 324 YSGTLENKIRVTVGTKEENQKFLALFKELTSNYDN 358
48478369  280 LP-LMPGYSRITIGSEDENNVAIKLIKNIK----- 308
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap