Conserved Protein Domain Family
PRK03963

?
PRK03963: PRK03963 
V-type ATP synthase subunit E; Provisional
Statistics
?
PSSM-Id: 167649
View PSSM: PRK03963
Aligned: 8 rows
Threshold Bit Score: 143.358
Threshold Setting Gi: 20094450
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
242399770   1 MEGARLIIEEINKEAEQKIKYILEEAEQKAEKIKQEAEKKARIKADWIIRKAQTQAELEKQRIIANAKLEVRRKKLVLQE 80 
14521963    1 MSGAELIIQEINREAERKIEYILNEAREEAEKIKEEAKRRAESKAEWILRRAKTQAELEKQRIIANARLEVRRKRLAVQE 80 
14591715    1 MNGAELIIQEINKEAERKIEYILNEARQQAEKIKEEARRNAEAKAEWIIRRAKTQAELEKQRIIANARLEVRRKRLAIQE 80 
33359457    6 MNGAQVIIQEINREAEQKIKYILDEARKEAEKIKEEARKRGESRAEWILRKAKTQAELEKQRIIATARLEVRRKKLSLQE 85 
240102201   1 MEGAELIIQEIHREAEQKIQYILSEAQREAEKLKEEARKRAQSQAEWILRKAKTQAEIEKQRIIANAKLEVRRKKLAVQE 80 
57641534    1 MEGAELIIQEINREAEQKIQYILSEAQKEAEKIKEEARKRAEDRAQWILRKAKTQAEMEKQRAIASARLEVRKKRLEVQE 80 
212224900   1 MEGAELIIQEINREAEQKIQYILSEAQKEAEKIREEARKRAQARAEWILRKAQTQAEIEKQRIIANAKLEIRKKRLEVQE 80 
20094450    1 -MGVEELERKILEDAEKEAEEILEEAKRDAERIREKAEREAEEVRREILDRARREAETRRRREIAQAKLEIRQERLRVKE 79 
242399770  81 ELINEVIGAIKDRLLSIPEA---EYMEILKDLIVTGIRELGEEKVVLSSNGETLSLLKAHLKEMEESVNeklgkDITISL 157
14521963   81 EIIRNVLDEVRKRLQEMPEE---EYFESIKALLKEAVEELKEGKVRVYSNERTLALISSRIEEIRDYLG-----SISIEI 152
14591715   81 EIISSVLEEVKRRLETMSED---EYFESVKALLKEAIKELNEKKVRVMSNEKTLGLIASRIEEIKSELG-----DVSIEL 152
33359457   86 EYISRVLKEVTSRLSNLSED---EYLETVLALLKEALKELDVKEIRVHSNEKTLALISSRIEEIRRELG-----DVSIEI 157
240102201  81 ELIGEVLSAMREKLAALPDD---EYFEALVSLTKEAIEELGTKKIVLRSNERTLKLIDSRMEEFSEKVG------VEVSL 151
57641534   81 EMIRAVLSALRERLASLPAD---EYFQTLVTLTTEALEELNIDSAVVRSNEETLKLIVEKLPEFKKSVSeklgkEVEITV 157
212224900  81 ALIQEVITALRERLAELPEE---EYFPMLVDLTGKAVEELGSGSVVVKSNERTLKLLEGRLDEFKKALTeklgrDVEVTL 157
20094450   80 EYIEKAIERAEEKIRELAEEgrkEYLEFLKRSAIEAVNAISSDEVVLRANENDLMLLDEMLSEIRDETG------KDVEL 153
242399770 158 GEPIETIGGVIVQNLEKTIRIDNTFEARMERLQADLRTKIAKILFG 203
14521963  153 GSAISTMGGVIVETEDGRIRIDNTFEARMERFEGEIRAKIAKVLFG 198
14591715  153 GETVDTMGGVIVETEDGRIRIDNTFEARMERFEGEIRSTIAKVLFG 198
33359457  158 GSPIQTIGGVIVETKDGNMRVDNTFEARMARLESELRSKIAEILFG 203
240102201 152 GEPIECIGGVLVESPDGTVRVDNTFDARIERLESELRATVAKALFG 197
57641534  158 GEPISTIGGVLVESSDGSVRVDNTFEARIERLEADLRARIAKALFG 203
212224900 158 GEPITTIGGILVETPDRTVRVDNTFESRIERFEGELRAAIAKALFG 203
20094450  154 GEPVEAVGGVIAESKDGSEAYDNTVDARLRRRRSEIVRRVSETLFG 199
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap