Conserved Protein Domain Family
PRK03887

?
PRK03887: PRK03887 
methylated-DNA--protein-cysteine methyltransferase; Provisional
Statistics
?
PSSM-Id: 167628
View PSSM: PRK03887
Aligned: 7 rows
Threshold Bit Score: 270.451
Threshold Setting Gi: 18978250
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
212224618   1 MLSVERFDIARKEVWIAVIFDEKIQGITFSLDGEGFLRERIANMAFFLKKR-GVNVELTLLESDYPRLVRDVILGKLENE 79 
18978250    2 ILEVRKFQVKNKAVYIGTLSEDKIFGIIFSIDEPEVIRHRIPTLINFLEKRlNKKLEIKEGNSGFSDVVFKTLIGKISNE 81 
14520606    1 MLSCESFKIKGREIIICVIWEEGIQGIVYSLDGREFLEKQLSRLISMLNKR-GVSLSLKERHSKYPELVFNVLTGKISNE 79 
14591584    4 MLTYKTFKILGREILIGVVWEEKIQGIAYSLDGLEFLKDQLSRVTSHLKSR-GVKVNLLEEKSRYPDLVFDVLKGKIGNE 82 
57641906    1 MLSVEKFRVGERVVWIGVIFSGRVQGIAFAFDRGTLMK-RIHDLAEHLGKR-GVSISLDVQPSDYPEKVFKVLIGELDNA 78 
240102382   1 MLAVERFGVNGRDIWIGVIFHGRIQGISFAFTRGELLE-RIRNLAEFLRGR-DVRVSLDVQPSNYTELVYRVLIGELENE 78 
242399002   1 MISIKSFQIGEKEIVIAILFDKKIQGITFSFDGEQFLQERVNALVEHLTNR-GVKVNLEERDSELPALVYKILIGEIRNQ 79 
212224618  80 ELLPELGFLGVTSFERRVYEWLTKRVKRGSVVTYGELAKTLGTSPRAIGGAMKRNPYPIVVPCHRVVAWDGPGYYTPKLE 159
18978250   82 EAAEFIEVSYLTKFERKLYIYLVENVKRGEVITYGELAKILNTSSRAVGAAVKRNPYPIIVPCHRVIGRKNPYLYTPKPE 161
14520606   80 EGFEELSLEGLTDFEIRVYSWLVKNVKRGEVITYGKVAKELKTSALAIGGAMKRNPYPIVVPCHRVVGKKDPWLYTPKPE 159
14591584   83 KGFEELSLEGLTRFEIKVYSWLVKNVKRGEVITYGKVAKALKTSPIAVGGAMKRNPYPIIVPCHRVVGKNNPWLYTPKPS 162
57641906   79 SFLRELSFEGVTPFEKKVYEWLTKNVKRGSVITYGDLAKALNTSPRAVGGAMKRNPYPIVVPCHRVVAHDGIGYYSSGIE 158
240102382  79 KALPELSFEGVTPFERRVYEWLTKNVKRGTVITYGSLAKALETSPRAVGGAMKRNPYPIIVPCHRVVSREGIGHYNLGIE 158
242399002  80 DGLEYLSFEGTTPFEKKVYETLTKKVKRGEVITYGELAKMLRSSPRAIGGAMKRNPYPIIVPCHRVIASNNIGNYTPKRE 159
212224618 160 YKAFLLKLEGveeWTS 175
18978250  162 YKKFLLEVEG---WTS 174
14520606  160 YKKFLLEVEG---WTS 172
14591584  163 YKKFLLEVEG---WIS 175
57641906  159 EKKFLLEIEGvkeWTS 174
240102382 159 EKKFLLELEGvkeWTG 174
242399002 160 YKRFLLETEGvktWTS 175
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap