Conserved Protein Domain Family
PRK03732

?
PRK03732: PRK03732 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 167593
View PSSM: PRK03732
Aligned: 6 rows
Threshold Bit Score: 173.581
Threshold Setting Gi: 240102581
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18978128    1 MVNIMDEIIVVTTPTIPGYKIIEVKGIARGGIVMATHLGRDILALLRNIKGGEVKEYTQMMAEAREEALRRMIEHAKKLG 80 
14520706    3 GMETIEGIIVVTTSEIPGYRIVEVKGIARGGVVRATHLGRDIMALLRNIKGGEVKEYTEMMAEAREEALRRMALHAKELG 82 
14591446    3 DMKTIEGIIVVTTPEIPGYKVVEVKGVARGGTVRATHIGRDIMALLRNLKGGEVKEYTEMMAEAREEALRRMALHAKELG 82 
240102581   3 CMETIEGVVVVTTETVPGYRIVEVKGLARGGVVKATHIGRDILAALRNIKGGEVKEYTQMMAEAREEALRRMALSAKELG 82 
57641861    1 -METVEGIMVVTTETIPGYRIVEVKGIARGGIVKATHIGRDIMAVLRNIKGGEVREYTQMMAEAREEALRRMALHAKELG 79 
212225085   1 ----MEDIIVVTTESVPGYRIVEIKGIARGGIVKATHLGRDITAFFRNIKGGEVKEYTQMMAEAREEALKRMILYAKELG 76 
18978128   81 ANAVVNFRFATSNVGGGMAEVYAYGTAVVVEREK 114
14520706   83 ANAVVNMRFATSNLGGSMAEIYAYGTAVVIEREE 116
14591446   83 ANAVVNFRFATSNLGGSMAEIYAYGTAVVVERVE 116
240102581  83 ANAVVNMRFATSNVSSNMAEVYAYGTAVVIEKEE 116
57641861   80 ANAVVNVRFATSNVGSSVAEVYAYGTAVVVEKEE 113
212225085  77 ANAVVNVRFATANIGSSVAEVYAYGTAVVVEKE- 109
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap