Conserved Protein Domain Family
PRK03717

?
PRK03717: PRK03717 
ribonuclease P protein component 2; Provisional
Statistics
?
PSSM-Id: 167589
View PSSM: PRK03717
Aligned: 7 rows
Threshold Bit Score: 226.626
Threshold Setting Gi: 14591267
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18977750    1 MSERPKTLPPTLRDKKRYIAFKVISENQFNKDEIKEAIWNACLRTLGELGTAKAKPWLIKFDETTQTGIIRCDRNHVYDV 80 
57641702    1 MREKPKYLPPTLRDKNRYIAFQVIGERPFKKDEIKKAVWEASLSALGYLGSARAKPWFIKFDEKSQTGIVRVDRKHVEEL 80 
14520893    1 -MMKLKTLPPTLRDKNRYIAFEIISDDEFTKDEVKSLIWEASLRVLGELGTALAKPWFIKYDPKTKTGIVRCDREYVEHL 79 
14591267    1 MMRKLKTLPPTLRDKNRYIAFEIISDGDFTKDEVKELIWKSSLEVLGETGTAIVKPWLIKFDPNTKTGIVRCDREYVEYL 80 
212224950   1 MKERPKTLPPTLRDKHRYIAFQVIGERTFTKDEIKRAIWEASLSTLGTLGSARAKPWFIKFNEKSQTGIVRVDRKHVEEL 80 
240102653   1 MREKPKYLPPTLREKHRYIAFQLIGERPFRKDEVKKAIWEASLSTLGVLGSAKAKPWFIRFDEKSQTGIVRVDRKHVEEL 80 
242399330   1 MRRKPKTLPPTLRDKNRYIAFQVTGERPFKKEMIKKAIWDVSLKTLGELGTARAKPWFIKFDEKTQTGIVRCDRKYVEEI 80 
18977750   81 IFSLTLVSDINGNKAIIKVLGVSGTIKRLKRKFLSQFGWR 120
57641702   81 RFALTMLTEINGSKVIFRTLGVSGTIKRLKRKFLAEYGWR 120
14520893   80 RFALMLATDFNGKRLIIRTLGVSGTIKRLKKKFLSQYGWK 119
14591267   81 RFALMLVSEFNGKRLIIRTLGVSGTIKRLKRKFLAKYGWK 120
212224950  81 RFALALVTHINGSKAIFRTLGVSGTIKRLKRKFLSEFGWK 120
240102653  81 RFALTLVTEINGSKAIFRTLGVSGTIKRLKRKFLAEFGWR 120
242399330  81 RFVLTLITEINGSKAIVRTLGVSGTIKRLKMKFLKEFGWK 120
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap