Conserved Protein Domain Family
PRK03670

?
PRK03670: PRK03670 
competence damage-inducible protein A; Provisional
Statistics
?
PSSM-Id: 167581
View PSSM: PRK03670
Aligned: 7 rows
Threshold Bit Score: 481.991
Threshold Setting Gi: 242398461
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18976848    1 MFAEIITVGDELLTGNTVNSNSAHIAKKLTERGYLVKRITTVGDDVEDIRSVILESLNRKPDVLIISGGLGPTHDDVTMV 80 
14521791    1 MKAEIITVGDELLTGNTVDSNSAFIASKLTEKGYLVRRITTVGDDVEEIKSIILEALDRKPDVLVISGGLGPTHDDVTML 80 
14590354    4 VLAEIITVGDELLTGNTVDSNSAYIAQRLTEKGFWVRRITTVGDDVKEIENAVREAISRKPEVLIISGGLGPTHDDVTML 83 
242398461   3 MFAEIITIGDELLTGNTVDSNSAFIAQKLTEKGYWVRRITTVGDDVEEIKTVVREVLSREPEVLVIAGGLGPTHDDVTML 82 
240103788   1 MFAEILTVGDELLTGNTVDSNSAFIAKKLTERGYWVRRITTVGDDVGDIKAAVLEILERKPEVLVISGGLGPTHDDVTML 80 
57641407    1 MFAEVLTIGDELLTGHTVDSNSAFIASKLTEQGYWVRRITTVGDDVEEIKAVVGEILARKPEVLVISGGLGPTHDDVTML 80 
212223786   1 MFAEILTIGDELLTGNTVDSNSAFIAQKLTERGYWVRRKTTVGDDVEEIKKVIHEILDRKPEVLIISGGLGPTHDDVTML 80 
18976848   81 AVAKALGKELVLCEKCLEEIKEFYERLYREGLIDDPTLNDARKKMAYLPKGAIPLKNSVGAAPGAYIEYRGTKIFVLPGM 160
14521791   81 AVSKALNRELELCEECLERIRKFYVELHKKGLIDDPELNEARKKMAYLPKGATPLQNTEGAAPGAFIEHEGIKIFVLPGM 160
14590354   84 GVANAIGRKLKLCEDCLERIKEFYEELHRKGLIDDPTLNEARKKMAYLPEGSEPLNNTEGAAPGAYVEYEGVKIFILPGM 163
242398461  83 AVARALNLELELREDILKRIEEFYLELYKKGFVDDPKINEARKKMAYIPRGVEILNNTVGAAPGAFLIYKNTKIFVLPGM 162
240103788  81 AVAEALGKKLVPCEECLERIREFYHRLYEKGLIDDPELNDARRKMAYLPEGAEPLENSEGAAPGAYIEHGKTKIFVLPGM 160
57641407   81 AVAEALGRKLVLCEKCLERIKAFYEKLYSEGYIDDPSLNEGRKKMAYLPEGAEPLENTGGAAPGAFIEHKGVKIFVLPGM 160
212223786  81 AVAEALGKNLTLCEPCIERIKAFYERLYKEGYIDDPKLNEGRKKMAYLPEGAVPLENTEGAAPGALIEHGGVKIFVLPGM 160
18976848  161 PREMKAMLEEEVLPRIGSKKFVQKKYLAEITDESKLAPILEETIKIFDVKIHSSPKGFGKFIGIIIFAQDEDTIKKAVEF 240
14521791  161 PREMKAMLLNEVLPRLGERTFIQKKYLAEITDESKLAPILSEAIRKFNVRIHSSPKGFGKYIGIIIFGEDEEIIEKVIEF 240
14590354  164 PREMKAMLESEVLPRLGERKFVQKKFLAEITDESKLAPILEDTIERFKVKIHSSPKGFGKYIGIIIFAEDDEVIGKVIRY 243
242398461 163 PREMKAMFENEVSPKLGKGKFIQRKLLAEITDESKLAPLLVEALNRFNIKIHSSPKGFGKYIGIILFGESEDEIERARRF 242
240103788 161 PREMKAMLEKEVLPRLGEKKFVQLKFLAEITDESKLAPILREALERFNVKIHSSPKGFGRYIGIIVFAESEVEAEKVVGF 240
57641407  161 PREMKAMLEKEVLPRLGRRKFLQRKFLAEITDESKLAPILREALERFNVRIHSSPKGFGKYIGLIIFAEDEGELEKTVEY 240
212223786 161 PREMKAMLEKEVLPRLGERKFIQRKLLAEITDESKLAPILIETLERFEVRIHSSPKGFGKYIGIIIFGESEEEIEKAKAF 240
18976848  241 MKSKGIEFREGW 252
14521791  241 MQSRGISFKEGW 252
14590354  244 IEGKGIKFREGW 255
242398461 243 IEERGIKFEEV- 253
240103788 241 LRERGISLQR-W 251
57641407  241 LESRGIRLEEA- 251
212223786 241 MEERGIRFEEGW 252
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap