Conserved Protein Domain Family
prsA

?
PRK03002: prsA 
peptidylprolyl isomerase PrsA
Statistics
?
PSSM-Id: 101162
View PSSM: PRK03002
Aligned: 20 rows
Threshold Bit Score: 445.149
Threshold Setting Gi: 152974691
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30261271    1 MRGKHIFIITALISILMLAACGQKNSSATVATATDSTITKSDFEKQLKDRYGKDMLYEMIAQDVITKKYKVSDDDVDKEV 80 
42780354    1 MRGKHIFIITALLSILMLSACGQKNDSDTVATATDSTITKSDFEKQLKDRYGKDMLYEMMAQDVITKKYKVSDDDVDKEL 80 
30019316    1 MRGKHIFIITALISILMLSACGQKNGSATVATATDSTITKDNFEKQLKDRYGKDMLYEMMAQDVITKKYKVPDEEVNKEV 80 
222094890   1 MRGKHIFIITALLSILMLSACGQKNDSDTVATATDSTITKSDFEKQLKDRYGKDMLYEMMAQDVITKKYKVSDDDVDKEL 80 
218896199   1 MRGKQIFIITALISILMLSACGQKNESATVATATDSTVTKDDFEKQLKDRYGKDMLYEMMAQDVITKKYKVSDEEVNKEV 80 
218232569   1 MRGKHIFIITALISILMLSACEQKNGSATVATATDSTITKDNFEKQLKDRYGKDMLYEMMAQDVITKKYKVPDEEVNKEV 80 
217958742   1 MRGKHIFIITALLSILMLSACGQKNDSDTVATATDSTITKSDFEKQLKDRYGKDMLYEMMAQDVITKKYKVSDDDVDKEL 80 
118476746   1 MRGKHIFIITALISILMLAACGQKNSSATVATATDSTITKSDFEKQLKDRYGKDMLYEMIAQDVITKKYKVSDDDVEKEV 80 
296501860   1 MRGKHIFIITALISILMLSACGQKNGSATVATATDSTITKDNFEKQLKDRYGKDMLYEMMAQDIITKKYKVPDEEVNKEV 80 
49480029    1 MRGKHIFIITALISILMLAACGQKNSSATVATATDSTITKSDFEKQLKDRYGKDMLYEMIAQDVITKKYKVSDDDVDKEV 80 
30261271   81 QKAKSQYGDQFKNVLKNNGLKDEADFKNQIKFKLSMNKAIKQSVTEKDVKDHYKPEIKASHILVSDENEAKEIKKKLDTG 160
42780354   81 QKAKNQYGDQFKNVLKNNGLKDEADFKNQIKFKLAMNEAIKKSITEKDVKDHYKPEIKASHILVSDENEAKEIKKKLDAG 160
30019316   81 EKVKKQYGDQFKKVLENYGLKDEEDFKNQIKFKLAMNEAIKKSITEKDVKDHYKPEIKASHILVSDENEAKEIKSKLDAG 160
222094890  81 QKAKNQYGDQFKNVLKNNGLKDEADFKNQIKFKLAMNEAIKKSITEKDVKDHYKPEIKASHILVSDENEAKEIKKKLDAG 160
218896199  81 EKVKKQYGDQFKKVLENNGLKDEEDFKNQIKFKLAMNEAIKKSITEKDVKDHYKPEIKASHILVSDENEAKEIKSKLDAG 160
218232569  81 EKVKKQYGDQFKKVLENYGLKDEEDFKNQIKFKLAMNEAIKKSITEKDIKDHYKPEIKASHILVSDENEAKEIKSKLDAG 160
217958742  81 QKAKNQYGDQFKNVLKNNGLKDEADFKNQIKFKLAMNEAIKKSITEKDVKDHYKPEIKASHILVSDENEAKEIKKKLDAG 160
118476746  81 QKVKNQYGDQFTAVLENNRLKDEADFKKQIKFKLAMNEAIKKSVTEKEVKAHYKPEIKASHILVSDENEAKEIKKKLDAG 160
296501860  81 EKVKKQYGDQFKKVLENYGLKDEEDFKNQIKFKLAMNEAIKKSITEKDVKDHYKPEIKASHILVSDENEAKEIKSKLDAG 160
49480029   81 QKAKNQYGDQFKNVLKNNGLKDEADFKNQIKFKLSMNKAIKQSVTEKDVKDHYKPEIKASHILVSDENEAKEIKKKLEAG 160
30261271  161 ASFEELAKQESQDLLSKEKGGDLGYFHSGAMTPEFETAAYKLKIGQISDPVQSPNGYHIIKLTGKKDLKPYDEVKNSIRK 240
42780354  161 ASFEELAKQESQDLLSKEKGGDLGYFNSGRMAPEFETAAYKLKVGQISNPVASPNGYHIIKLTDKKALKPYDEVKDSIRK 240
30019316  161 ASFEELAKQESQDLLSKDKGGDLGYFNSGTMAPEFETAAYKLNVGQISNPVKSSNGYHVIKLTDKKALKPYDEVKDSIRK 240
222094890 161 ASFEELAKQESQDLLSKEKGGDLGYFNSGRMAPEFETAAYKLKVGQISNPVASPNGYHIIKLTDKKELKPYDEVKDSIRK 240
218896199 161 ASFEELAKQESQDLLSKDKGGDLGYFNSGTMAPEFETAAYKLNVGQISNPVKSSNGYHVIKLTDKKDLKPYDEVKNSIRK 240
218232569 161 ASFEELAKQESQDLLSKDKGGDLGYFNSGTMAPEFETAAYKLNVGQISNPVKSSNGYHVIKLTDKKDLKPYDEVKNSIRK 240
217958742 161 ASFEELAKQESQDLLSKEKGGDLGYFNSGRMAPEFETAAYKLKVGQISNPVASPNGYHIIKLTDKKALKPYDEVKDSIRK 240
118476746 161 ASFEELAKQESQDLLSKEKGGDLGYFNSGRMAPEFETAAYKLKVGQISNPVKSPNGYHIIKLTDKKELKPYDEVKDSIRK 240
296501860 161 ASFEELAKQESQDLLSKDKGGDLGYFNSGTMAPEFETAAYKLNVGQISNPVKSSNGYHVIKLTDKKDLKPYDEVKNSIRK 240
49480029  161 ASFEELAKQESQDLLSKEKGGDLGYFNSGRMAPEFETAAYKLKIGQISNPVKSPNGYHIIKLTDKKELKPYDEVKDSIRK 240
30261271  241 NLEEERTADPIFGKKLLQSELKKANIKINDSELEDTFTIVSPQGN 285
42780354  241 NLEEERISDPIFGKKLLQKELKKANIKINDSELKDTFTLTREQEN 285
30019316  241 NLEEERTADPVFSKKLLQEELKKANIKINDSDLKDTFTLVSPQGN 285
222094890 241 NLEEERISDPIFGKKLLQNELKKANIKINDSELEDTFALVYEPAN 285
218896199 241 NLEEERTADPVFSKKLLQEELKKANIKINDSDLKDTFTLVSPQGN 285
218232569 241 NLEEERTADPVFSKKLLQEELKKANIKINDSDLKDTFTLVSPQGN 285
217958742 241 NLEEERISDPIFGKKLLQNELKKANIKINDSELKDTFTLVHEQGN 285
118476746 241 NLEEERIADPTFSHKLLQKELKKANIKINDSELEDTFTIVSPQGN 285
296501860 241 NLEEERTADPVFSKKLLQEELKKANIKINDSDLKDTFTLTREQEN 285
49480029  241 NLEEERIADPTFSHKLLQKELKKANIKINDSELEDTFTIVSSQGN 285
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap