Conserved Protein Domain Family
psbZ

?
PRK02576: psbZ 
photosystem II reaction center protein PsbZ
Statistics
?
PSSM-Id: 167400
View PSSM: PRK02576
Aligned: 21 rows
Threshold Bit Score: 50.0504
Threshold Setting Gi: 113475142
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
166365962   1 MSIVFQFFLIALVLFSLLMVIGVPVAYASPQNWDQSKPLLYVGSAIWAILVVAVAILNFLVI 62 
170076768   1 MTILFQLALAALVALSFLMVIGVPVAYASPTNWEQSKSLIFVGSIAWTVLVIAVGVLNFFVI 62 
148238423   1 MQILNTLTVLALVVMSFALIVAVPVLYASNEDSGRSNRLILLGGIAWVALVLVNWGMSFFVV 62 
113953382   1 MQILNTLTVLALVVMSFALIVAVPVLYASNEDSGRSNRLILLGGIAWVALVLLNWGVSYFVV 62 
33864617   24 MQFLNTLTVLALVVMSFALIVAVPVLYASSEDSGRSNRLILLGSAVWVALVLLNWGVSFFVV 85 
78211631   48 MQFINTLTVLALVVASFALIVAVPVLYASSEDSGRSNRLILLGSAVWVALVLLNWGVSFFVV 109
148241178   1 MQILNTLTVLALVVMSFALIVAVPVLYASNDESGNSNRLILFGGLAWVGLVLLNWGMSFFVV 62 
78183666    1 MQFLNTLTVLALVVTSFALIVAVPVLYASTEDSGRSNRLILLGGGVWVALVLLNWGMSFFVV 62 
81301054    1 MVILFQLALLLLVVMSFVLIVGVPVLYATNGDRVQSNRLILVGGLAWTALVVLVGVLNYFVV 62 
220907973   1 MTFLFQLALAALVILSFAMIVGVPVAYASPQNWDSSKRLIFLGSGVWIGLVLVVAALNFLVV 62 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap