Conserved Protein Domain Family
psbK

?
PRK02553: psbK 
photosystem II reaction center protein K; Provisional
Statistics
?
PSSM-Id: 167396
View PSSM: PRK02553
Aligned: 38 rows
Threshold Bit Score: 40.4371
Threshold Setting Gi: 33239756
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
166363931  1 METALLLAKLPEAYQIFDPLVDVLPLIPLFFLLLAFVWQASVGFK 45 
86606579   1 MPAMMLLAALPEGYELFDPLIDILPIIPVLFFLLAFVWQAAVGFK 45 
86607606   1 ---MVFLASLPEGYELFDPLIDILPIIPVLFFLLAFVWQAAVGFK 42 
124024180  3 AFTLDLMAQLPEAYQAYAPAVDVLPLIPIFFFLLVFVWQASVGFR 47 
33864130   3 AFTLDLMAQLPEAYQAYAPAVDVLPLIPIFFFLLVFVWQASVGFR 47 
159902840  8 PLTLDLLAQLPEAYRIYAPTVDVLPLIPLLFFLLVFVWQAAVGFR 52 
157412633  2 LILLNTFAELPEAYKAFAPTVDVLPLIPLFFFLLVFVWQAAVGFK 46 
123965540  2 LTLLNTFAELPEAYKAFAPTVDVLPLIPLFFFLLVFVWQAAVGFK 46 
33860830   2 LTLLNTFAELPEAYKAFAPTVDVLPLIPLFFFLLVFVWQAAVGFK 46 
33239756   3 PLTLDLLAQLPEAYQLYAPTVDVLPLIPLLFFLLVFVWQAAVGFR 47 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap