Conserved Protein Domain Family
petN

?
PRK02529: petN 
cytochrome b6-f complex subunit PetN; Provisional
Statistics
?
PSSM-Id: 134722
View PSSM: PRK02529
Aligned: 18 rows
Threshold Bit Score: 41.002
Threshold Setting Gi: 81299286
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148239547  1 MLFTLAWASLAAVFSFSIAMVVWGRNGDGTLNF 33 
113952797  1 MLFTIAWASLAAVFSFSIAMVVWGRNGDGTLNF 33 
33865837   1 MLFTVAWASLAAMFSFSIAMVVWGRNGDGTLNF 33 
78212973   1 MLFTLGWASLAAMFSFSIAMVVWGRNGDGTLNF 33 
78184629  25 VLFTVAWASLAAMFSFSIAMVVWGRNGDGTLKF 57 
81299286   1 --MTFGWAALLAVFTFSLAMVVWGRNGDGSIGF 31 
56751053   2 ELLTFGWAALLAVFTFSLAMVVWGRNGDGSIGF 34 
33240368   1 MLFTFAWASLAAIFTFSIAMVVWGRNGDGTIDL 33 
33862945   1 MLFTLAWASLAAVFSFSIAMVVWGRNGDGTLNF 33 
159903382  1 MLFTFAWASLAAIFTFSIAMVVWGRNGDGTIDF 33 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap