Conserved Protein Domain Family
PRK02478

?
PRK02478: PRK02478 
Maf-like protein; Reviewed
Statistics
?
PSSM-Id: 167380
View PSSM: PRK02478
Aligned: 23 rows
Threshold Bit Score: 326.694
Threshold Setting Gi: 159184119
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
82700823    1 MTVKLVLASKSPFRSALLKNAGIEFSTASADIDERAVEAPLYESGATPEDVAQILAEAKAIDVSEKNPGAVVIGCDQTLS 80 
159184119   1 MKQELILASSSASRQMLMRNAGLTFSAIPADIDERALDEQLERDGASPEEVALELARAKALAVSALHPEALVLGCDQTMA 80 
222087933   1 MTMPLILASSSPFRRMLMENAGMHFQAIAADIDERAIEAPLERDGAGPDAVALVLAKAKAKEVSDRFPGSLVIGSDQTMS 80 
227823861   1 MTTSLVLASASPFRRALLENAGLTFSARAAQIDERVLEQPLEEAGASPVDVALTLAEAKARDVSRHFDGAIVIGSDQTMS 80 
241206945   1 MTPKLILASSSPYRRMLMENAGLSFEAHAARIDERAVEAPLEKAGTKPDAVALVLARAKAEEVSSRFPDSLVIGSDQTMS 80 
209551507   1 MTTKLILASSSPFRRMLMENAGLSFEAHAAQIDERAVEAPLEKAGAQPDAVALVLARAKAEEVSSRFPDGLVIGSDQTMS 80 
116249768   1 MTPKLILASSSPFRRMLMENAGLSFEAHAARIDERAVEAPLENAGAKPDAVALVLARAKAEEVSSRFPDSLVIGSDQTMS 80 
86355671    1 MTPKLILASSSPFRRMLMENAGLFFEAHPAEIDERAVEAPLEKAGAKPDTVACVLAKAKAEDVSARFPESLVIGSDQTMS 80 
190889642   1 MTTTIILASSSPFRRMLMENAGLSFEAHAAKIDERALEAPLEKAGATPDAVALALARAKAEDVSRHFSDSLVIGSDQTMS 80 
150398402   1 MRPSLVLASASPFRRTLLVNAGLSFEARAAEIDERALEQPLESSGASPADVALVLAEAKAKDVARHFPGALVIGSDQTMS 80 
82700823   81 LGDEIFHKPHDMEAARRQLQKISGKTHQLNSAVVLARDGKTLWRHVSIAHMTMRDLDAGFIGRYIGRVGDIALSSVGAYQ 160
159184119  81 LGTRVYHKPKNMAEAATHLLSLSGKVHRLNSAAVLVHNGKVVWQTVSSAELAVRTLSAEFVSRHLQRVGEKALSSVGAYQ 160
222087933  81 LGSQVFHKPKTMGEAESHLQSLSAKTHRLNSGIALALNGDIVWEHVSHAELTMRDLSADFIHRHLTRVGEKALSSVGAYQ 160
227823861  81 LGTRVYHKPKDMAEAAEHLLSLSGRMHSLNSAIVLVRDGEVLWRHVSTAHMTVRLLDRGFVERHLKRVGEKALSSVGAYQ 160
241206945  81 LGDSVFHKPKDMTDAASHLQALSGVTHRLNSAVAIVSNGVVLWEHLAHAELTMRPLTVEFIARHLARVGERALFSVGAYQ 160
209551507  81 LGDRVFHKPTDMVEAANHLQTLSGATHRLNSAVAIVRNGVVVWEHLAHADLTMRPLTADFIGRHLARVGNKALSSVGAYQ 160
116249768  81 LGDSVFHKPTDLADAASHLQALSGVTHRLNSAVAIVSDGVVLWEHLAHAQLTMRPLTVEFIARHLARVGERALSSVGAYQ 160
86355671   81 LGDRVFHKPKDIADAANHLRALSGTTHRLNSAIVLVRDGAVLWEHVGHAELTMRPLTEDFIARHLSRVGERALSSVGAYQ 160
190889642  81 LAERVFHKPKDMADAASHLHALSGKTHRLNSAVAIVNNGVVLWEHLAHAELTMRPLTADFIARHLARVGDKALSSVGAYQ 160
150398402  81 LGSRVYHKPRDLAEAAEHLLSLSGKTHSLNSAVVLIRDDAVVWRHVSTASMTVRRLRQGFIDRHLERVGAKALTSVGAYQ 160
82700823  161 VEGPGIQLFEKIDGDYFTIVGLPLLPLLAELRREKCIDG 199
159184119 161 LEREGIQLFTSIEGDYFTILGLPLLPLLSKLRDMDVIDG 199
222087933 161 LEGEGIQLFSKIDGDYFTILGLPMLPLLQKLRELGAIDG 199
227823861 161 LEGEGIQLFEKIEGDYFTILGLPMLPLLEKLRELGSIDA 199
241206945 161 LEGEGIQLFEKIVGDYFTILGLPMLPLLKKLRELGAVDG 199
209551507 161 LEGEGIQLFEKIEGDYFTILGLPMLTLLEKLRDLGAIDG 199
116249768 161 LEGEGIQLFEKIEGDYFTILGLPMLPLLKKLRELGAIDG 199
86355671  161 LEGEGVQLFEKIEGDYFTILGLPMLPLLGKLRELGTIDG 199
190889642 161 LEGQGIQLFEKIEGDYFTILGLPMLPLLKKLRELGAIDG 199
150398402 161 LEGEGIQLFERIDGDYFTILGLPMLPLLSRLREMGAIDA 199
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap