Conserved Protein Domain Family
PRK02269

?
PRK02269: PRK02269 
ribose-phosphate diphosphokinase
Statistics
?
PSSM-Id: 167353
View PSSM: PRK02269
Aligned: 53 rows
Threshold Bit Score: 525.127
Threshold Setting Gi: 254556981
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116492929   5 KTKRRMKIFSLNSNHALSEKIAAEVGMPLGKAAIKQFSDGEIQVNIEESIRGDEVYVIQSISDPINDSLMELLIMVDALR 84 
253752842   1 MAFTDLKLFALSSNQKLAEQVSKKIGIPLGKSSVRQFSDGEIQVNIEESIRGTHVYILQSTSSPVNDNLMEILIMVDALK 80 
146319873   1 MAFTDLKLFALSSNQKLAEQVSKKIGIPLGKSSVRQFSDGEIQVNIEESIRGTHVYILQSTSSPVNDNLMEILIMVDALK 80 
253750943   1 MAFTDLKLFALSSNQKLAEQVSKKIGIPLGKSSVRQFSDGEIQVNIEESIRGTHVYILQSTSSPVNDNLMEILIMVDALK 80 
253754667   1 MAFTDLKLFALSSNQKLAEQVSKKIGIPLGKSSVRQFSDGEIQVNIEESIRGTHVYILQSTSSPVNDNLMEILIMVDALK 80 
157149947   1 MSFSDLKLFALSSNQELAKRVAKGIGMELGKSTVRQFSDGEIQVNIEESIRGKHVFILQSTSSPVNDNLMEILIMVDALK 80 
116511629   1 MSYSNLKLFSLSSNHELAQKVAKEIGIELGKVSVGAHSDGETVVHIDESVRGDHVFILQSTSDPVNNNLMELLIMMDALR 80 
125624533   1 MSYSNLKLFSLSSNHELAQKVAKEIGIELGKVSVGAHSDGETVVHIDESVRGDHVFILQSTSDPVNDNLMELLIMMDALR 80 
15672796    1 MSYSNLKLFSLSSNHELAQKVAKEIGIELGKVSVGAHSDGETVVHIDESVRGDHVFILQSTSDPVNDNLMELLIMMDALR 80 
281491308   1 MSYSNLKLFSLSSNHELAQKVAKEIGIELGKVSVGAHSDGETVVHIDESVRGDHVFILQSTSDPVNDNLMELLIMMDALR 80 
116492929  85 RASASQINVVIPYYGYSRQDRKARSREPITAKLIANLLEDDAITRVLTLDLHAPQIQGFFDVPVDHLAAAPLLASYFSDG 164
253752842  81 RASAESVNVVMPYYGYARQDRKARAREPITSKLVANMLQTAGVNRLLTIDLHAAQIQGFFDIPVDHLMGAPLIADYFERR 160
146319873  81 RASAESVNVVMPYYGYARQDRKARAREPITSKLVANMLQTAGVNRLLTIDLHAAQIQGFFDIPVDHLMGAPLIADYFERR 160
253750943  81 RASAESVNVVMPYYGYARQDRKARAREPITSKLVANMLQTAGVNRLLTIDLHAAQIQGFFDIPVDHLMGAPLIADYFERR 160
253754667  81 RASAESVNVVMPYYGYARQDRKARAREPITSKLVANMLQTAGVNRLLTIDLHAAQIQGFFDIPVDHLMGAPLIADYFERR 160
157149947  81 RASAESINVVMPYYGYARQDRKARAREPITSKLVANMLEIAGVDRLLTIDLHASQIQGFFDIPVDHLMGAPLIANYFERR 160
116511629  81 RASAASINIVLPYYGYARQDRKARAREPITSKLVANMLQIAGADRLITFDLHAPQIQGFFNIPVDLLMGSPLIAEYFRRQ 160
125624533  81 RASAASINIVLPYYGYARQDRKARAREPITSKLVANMLQIAGADRLITFDLHAPQIQGFFNIPVDHLMGSPLIAEYFRRQ 160
15672796   81 RASAASINIVLPYYGYARQDRKARAREPITSKLVANMLQIAGADRLITFDLHAPQIQGFFNIPVDHLMGSPLIAEYFRRQ 160
281491308  81 RASAASINIVLPYYGYARQDRKARAREPITSKLVANMLQIAGADRLITFDLHAPQIQGFFNIPVDHLMGSPLIAEYFRRQ 160
116492929 165 SF-DVENMVVVSPDHASVSRARTMAELLGTPIAIIDNRNEESVESINEIpTEIIGNVKNKIALVVDDMIDTGTRLTISAE 243
253752842 161 GM-VGDGYVVVSPDHGGVTRARKLAQFLKTPIAIIDKRRSVDKMNTSEV-MNIIGDIKDKTCILIDDMIDTAGTICHAAD 238
146319873 161 GM-VGDGYVVVSPDHGGVTRARKLAQFLKTPIAIIDKRRSVDKMNTSEV-MNIIGDIKDKTCILIDDMIDTAGTICHAAD 238
253750943 161 GM-VGDGYVVVSPDHGGVTRARKLAQFLKTPIAIIDKRRSVDKMNTSEV-MNIIGDIKDKTCILIDDMIDTAGTICHAAD 238
253754667 161 GM-VGDGYVVVSPDHGGVTRARKLAQFLKTPIAIIDKRRSVDKMNTSEV-MNIIGDIKDKTCILIDDMIDTAGTICHAAD 238
157149947 161 GM-IGSDYVVVSPDHGGVSRARKLAEFLKTPIAIIDKRRSVDKMNTSEV-MNIIGNVKGKTCILIDDMIDTAGTICHAAD 238
116511629 161 LVsAGDDIVVVSPDHGGVGRARKLANFLKAPLAIIDKRRP--RANVAEI-MNIIGDVQGKKCILIDDMIDTAGTITLAAN 237
125624533 161 LVsAGDDIVVVSPDHGGVGRARKLANFLKAPLAIIDKRRP--RANVAEI-MNIIGDVQGKKCILIDDMIDTAGTITLAAN 237
15672796  161 LVsAGDDIVVVSPDHGGVGRARKLANFLKAPLSIIDKRRP--RANVAEI-MNIIGDVQGKKCILIDDMIDTAGTITLAAN 237
281491308 161 LVsAGDDIVVVSPDHGGVGRARKLANFLKAPLAIIDKRRP--RANVAEI-MNIIGDVQGKKCILIDDMIDTAGTITLAAN 237
116492929 244 ALHNAGATEVYGAATHAIFSNNAPKILQESKLSKIIVTDSIRIDADKKFDKLVELSVGPLLGNAIKMIYDNEPLAPLFKS 323
253752842 239 ALADAGATAVYASCTHPVLSGPAMDNISKSAIKKLVVLDTIEIAEDRLIDKIEHISTAELLAEAIIRIHEKRPLSPLFEA 318
146319873 239 ALADAGATAVYASCTHPVLSGPAMDNISKSAIKKLVVLDTIEIAEDRLIDKIEHISTAELLAEAIIRIHEKRPLSPLFEA 318
253750943 239 ALADAGATAVYASCTHPVLSGPAMDNISKSAIKKLVVLDTIEIAEDRLIDKIEHISTAELLAEAIIRIHEKRPLSPLFEA 318
253754667 239 ALADAGATAVYASCTHPVLSGPAMDNISKSAIKKLVVLDTIEIAEDRLIDKIEHISTAELLAEAIIRIHEKRPLSPLFEA 318
157149947 239 ALAEAGAVDVYASCTHPVLSGPAMENIQKSAIKKLVVLDTIYLPQERLIDKIEQISIADLLSEAIIRIHEKRPLSPLFEI 318
116511629 238 ALKELGATEVYASCTHAVLSGPAIDRINNSAITKLVVLDTIEMPEERQSEKIVQLSIAHLLADAIIRIHERRPLSPLFEL 317
125624533 238 ALKELGATEVYASCTHAVLSGPAIERINNSAITKLVVLDTIEMPEERQSEKIVQLSIAHLLADAIIRIHERRPLSPLFEL 317
15672796  238 ALKELGATEVYASCTHAVLSGPAIERINNSAITKLVVLDTIEMPEERQSEKIVQLSIAHLLADAIIRIHERRPLSPLFEL 317
281491308 238 ALKELGATEVYASCTHAVLSGPAIERINNSAITKLVVLDTIEMPEERQSEKIVQLSIAHLLADAIIRIHERRPLSPLFEL 317
116492929 324 QK 325
253752842 319 SR 320
146319873 319 SR 320
253750943 319 SR 320
253754667 319 SR 320
157149947 319 GK 320
116511629 318 HL 319
125624533 318 HL 319
15672796  318 HL 319
281491308 318 HL 319
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap