Conserved Protein Domain Family
ppnK

?
PRK02231: ppnK 
NAD(+) kinase
Statistics
?
PSSM-Id: 167337
View PSSM: PRK02231
Aligned: 14 rows
Threshold Bit Score: 531.688
Threshold Setting Gi: 219871462
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
68248622    1 MHKNLFHWLMERGYQVLVEKEVAITLELPFEHlaTLEEIGHRAQLAIVIGGDGNMLGRARVLAKYDIPLIGINRGNLGFL 80 
126207700  25 THLAVYNWLKDRHYRVLVEKSIAQQLNLPEAR--SLEEIGQQANLVIVIGGDGNMLGMARRLAEYQVPLIGINRGNLGFL 102
152978561  32 MHRNIFQWLREQGYEVLVEDSVGEALKLSPDHiaSLEQIGQRAQLAIVIGGDGNMLGRARVLSKFDIVMIGINRGNLGFL 111
190149483  25 THLAVYNWLKDRHYRVLVEKSIAQQLNLPEAR--SLEEIGQQANLVIVIGGDGNMLGMARRLAEYQVPLIGINRGNLGFL 102
165975668  25 THLAVYNWLKDRHYRVLVEKSIAQQLNLPEAR--SLEEIGQQANLVIVIGGDGNMLGMARRLAEYQVPLIGINRGNLGFL 102
148827222  25 MHKNLFHWLMERGYQVLVEKEVAITLELPFEHlaTLEEIGRRAQLAIVIGGDGNMLGRARVLAKYDIPLIGINRGNLGFL 104
33152812   29 THLAVYNWLKDRHYSVLVEEKIAEQLQLPNGK--RIEEIGQIADLVIVIGGDGNMLGMARSLAKYQVPLIGINRGNLGFL 106
15602198   33 MHKNLFQWLLEKGYQVLVERPIGEQLGLSENYlaSVDEIGQQAQLAIVIGGDGNVLGRARTLAKYDIALIGINRGNLGFL 112
113460795  33 MHKNLFHWLSERGYQVLVEREIGERLGLSVNHlaDLDEIGCLAHLAIVIGGDGNMLGRARVLAKYNIPLIGINRGNLGFL 112
170719177  33 MHKNLFHWLSERGYQVLVEREIGERLGLSVNHlaDLDEIGCLAHLAIVIGGDGNMLGRARVLAKYNIPLIGINRGNLGFL 112
68248622   81 TDIDPKNAYSQLEACLERGEFFVEERFLLEAKIERASEIVSTSNAVNEAVIHPAKIAHMIDFHVYINDKFAFSQRSDGLI 160
126207700 103 TDIAPHSTFEQLHNCIERGEFVIEERFLLEARIERNGKIIATNNALNEVVIHPTQVARIIEFEVYIDGKFAFSQRSDGLI 182
152978561 112 TDIDPKNAYAQLQACLN-GEFFVEERFQLDVDIIRDGKVIASGNAINETVIHPAKVAHMIDFHVYIDDKFAFSQRSDGLI 190
190149483 103 TDIAPHSTFEQLHNCIERGEFVIEERFLLEARIERNGKIIATNNALNEVVIHPTQVARIIEFEVYIDGKFAFSQRSDGLI 182
165975668 103 TDIAPHSTFEQLHNCIERGEFVIEERFLLEARIERNGKIIATNNALNEVVIHPTQVARIIEFEVYIDGKFAFSQRSDGLI 182
148827222 105 TDIDPKNAYSQLEACLERGEFFVEERFLLEAKIERASEIVSTSNAVNEAVIHPAKIAHMIDFHVYINDKFAFSQRSDGLI 184
33152812  107 TDIAPQSAFEQLYSCLEKGEFIIEQRFLLEAQIEQNGKIISANNALNEVAIHPTQVARIIEFEVYIDSKFAFSQRSDGLI 186
15602198  113 TDIDPKNAYSQLQACLEDGDCFVEERFILEASVERNGKIIARGNAVNEAVVHPAKIAHMIDFHVYINDKFAFSQRSDGLI 192
113460795 113 TDIDPKNAYAQLEACLERGEFFVEERFLLEASIERNGEVVAQSNAINETVIYPAKIAHMIDFHVYINDKFAFSQRSDGLI 192
170719177 113 TDIDPKNAYAQLEACLERGEFFVEERFLLEASIERNGEVVAQSNAINETVIYPAKIAHMIDFHVYINDKFAFSQRSDGLI 192
68248622  161 VSTPTGSTAYSLSAGGPILTPNLNAIALVPMFPHKLTSRPLVVDGDSKISIRFAEHNTSQLEVGCDSQITLPFTPDDVVH 240
126207700 183 ISTPTGSTAYSLSAGGPILTPNMNAIALVPMHPHTLSSRPLVIDGDSQISLRFAQYNQPSLEVSCDGQYDLPFTPEDRII 262
152978561 191 IATPTGSTAYSLSAGGPILTPQLNAIALVSMFPHTLSSRPLVIDGNSKISLRFAEYNTPQLEANCDGQFALHFTSDDIIT 270
190149483 183 ISTPTGSTAYSLSAGGPILTPNMNAIALVPMHPHTLSSRPLVIDGDSQISLRFAQYNQPSLEVSCDGQYDLPFTPEDRII 262
165975668 183 ISTPTGSTAYSLSAGGPILTPNMNAIALVPMHPHTLSSRPLVIDGDSQISLRFAQYNQPSLEVSCDGQYDLPFTPEDRII 262
148827222 185 VSTPTGSTAYSLSAGGPILTPNLNAIALVPMFPHTLTSRPLVVDGDSKISIRFAEHNTSQLEVGCDSQITLPFTPDDVVH 264
33152812  187 IATPTGSTAYSLSAGGPILTPNMNAIALVPMHPHALSSRPLVIDGDSHISLRFAQYNQPNLEISCDGQDDLPFTPEDRII 266
15602198  193 ISTPTGSTAYSLSAGGPILTPQLNAIALVPMFPHTLSSRPLVIDGDSKISIRFAEYNTSQLEVGCDSQVALEFSPDDIVH 272
113460795 193 ISTPTGSTAYSLSAGGPILTPQLNAIALVSMFPHTLSSRPLVIDADSKISVRFAEYNTSQLEVGCDSQVALSFTPDDIVH 272
170719177 193 ISTPTGSTAYSLSAGGPILTPQLNAIALVSMFPHTLSSRPLVIDADSKISVRFAEYNTSQLEVGCDSQVALSFTPDDIVH 272
68248622  241 IQKSEHKLRLLHLKNYNYYNVLSSKLGWLKSF 272
126207700 263 VEKSPNKLRLLHLKDYNYFTVLGSKLGWSSKL 294
152978561 271 VKKAPHPLRLLHLKNYNYYNVLSSKLGWLKKL 302
190149483 263 VEKSPNKLRLLHLKDYNYFTVLGSKLGWSSKL 294
165975668 263 VEKSPNKLRLLHLKDYNYFTVLGSKLGWSSKL 294
148827222 265 IQKSEHKLRLLHLKNYNYYNVLSSKLGWLKSF 296
33152812  267 VRKSPDILHLLHLKDYNYFTVLGSKLGWSSKL 298
15602198  273 IQKSPDKLRLLHLKNYNYYKVLSSKLGWLRNS 304
113460795 273 ITKSQDKLRLLHLKNYNYYNVLSTKLGWLKNL 304
170719177 273 VTKSQDKLRLLHLKNYNYYNVLSTKLGWLKNL 304
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap