Conserved Protein Domain Family
PRK02166

?
PRK02166: PRK02166 
hypothetical protein; Reviewed
Statistics
?
PSSM-Id: 167325
View PSSM: PRK02166
Aligned: 19 rows
Threshold Bit Score: 280.505
Threshold Setting Gi: 53803085
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
77461656    1 MPIQNSPYQGFATLLNSSGHSVSPAELHGLLLGRSCAGAGFNAEEWLIDAA-----ELLESEPQDNVRNALIGLQEMVKS 75 
116053372   1 MSTQNSAYSAFSSLLAEAAMPVSPAELHGHLLGRVCAGAGFDEAAWQHAAA-----ELLGGAPGERLKAALSGLLGMVRQ 75 
15600418    1 MSTQNSAYSAFSSLLAEAAMPVSPAELHGHLLGRVCAGAGFDEAAWQHAAA-----ELLGGAPGERLKAALSGLLGMVRQ 75 
218894327   1 MSTQNSAYSAFSSLLAEAAMPVSPAELHGHLLGRVCAGAGFDEAAWQHAAA-----ELLGGAPGERLKAALSGLLGMVRQ 75 
146305365   1 MSTSSSPYAAFAALLSSAGHSVSPAELHGLLLGRSCAGAGFDADAWLLDAA-----DLLGGEPQDSVRQALIGLQEMVKG 75 
146284383   6 MSIQNSPYAAFATLLAGSPQSVSPAELHGLLLGRSCAGAGFDVEPWLLDAS-----DLLGEAPQDNVRQALIGLQEMVKG 80 
71737785    1 MPIQNSPYKAFATLLNSGGHQVSPAELHGLLLGRSCAGAGFDNEGWFADAS-----VLLETEPQDNIRQALIGLQEMVKG 75 
66043589    1 MPIQNSPYKAFATLLNSGGHKVSPAELHGLLLGRSCAGAGFDSEGWFADASmlletELLETEPQENIRAALVGLQEMVKG 80 
28872336    1 MPIQNSPYKAFATLLNSGGHKVSPAELHGLLLGRSCAGAGFDNEGWFADAS-----MLLETEPQDNIRAALVGLQEMVKG 75 
226946741   1 MSTDKSPYAAFSALLASSGRDRSPAELHGQLLGRSCAGAGFEVDAWLADAA-----DLLGGQIPDNVRQALIGLQEMVKG 75 
77461656   76 ELTGDDVTVVLLLPNDDAPLAERAAALGEWCQGFLTGFGLNCRDSSmLSTEATEVLQDLAAISQVQDALEESEDGESDYM 155
116053372  76 DFSAGEVAVVMLLPDDETPLAQRTEALGQWCQGFLAGFGLTAREGS-LTGEAEEVLQDMAAIAQVQGQLEDSEDGETDYM 154
15600418   76 DFSAGEVAVVMLLPDDETPLAQRTEALGQWCQGFLAGFGLTAREGS-LTGEAEEVLQDMAAIAQVQGQLEDSEDGETDYM 154
218894327  76 DFSAGEVAVVMLLPDDETPLAQRTEALGQWCQGFLAGFGLTAREGS-LTGEAEEVLQDMAAIAQVQGQLEDSEDGETDYM 154
146305365  76 ELCSEDMAVVLLLPDDETPLAQRAVALGQWCQGFLGGFGLTARDGA-LSAEAMEVLQDLSAIAQVQSALEESEDGENDYM 154
146284383  81 ELAGDDIAIVLLLPSDDAPLAERAVALGQWCQGFLAGFGLTAGDRA-LSSEAMEVLQDLSAIAQIQDSLEESEDGETDYM 159
71737785   76 ELTGDDMTVVLLLPGDDEPLTERAAALGQWCQGFLAGFGLAIGDKT-LGTEAKDVLEDLAAIAQVQDALDESEDGETDYM 154
66043589   81 ELTGDDMTVVLLLPGDDEPLTERAAALGQWCQGFLAGFGLSIGDKV-LGSEAKAVLEDLAAIAQVQDALEESEDGETDYM 159
28872336   76 ELTGDDMTVVLLLPGDDEPLTERAAALGQWCQGFLAGFGLAIGDKV-LGSEAKAVLEDLAAIAQVQDALEESEDGETDYM 154
226946741  76 ELTGGEVAVVLLLPSDEAPLAERAAALGQWCQGFLGGFGLAAGDRP-LSAEAMEVLQDLAAISQVQSALEDSEEGEGAYM 154
77461656  156 EVMEYLRVAPLLLFSETKKAdVPPAAKPSLH 186
116053372 155 EVMEYLRVAPLLLFAECGKP-LEPAPKPSLH 184
15600418  155 EVMEYLRVAPLLLFAECGKP-LEPAPKPSLH 184
218894327 155 EVMEYLRVAPLLLFAECGKP-LEPAPKPSLH 184
146305365 155 EVMEYLRVAPLLLFTECAKP-AAPAAKPSLH 184
146284383 160 EVMEYLRVAPLLLFTECAKP-LPAAAKPSLH 189
71737785  155 EVMEYMRVAPLLLFTEFNEP-AAPQPKPSLH 184
66043589  160 EVMEYMRVAPLLLFTEFNEP-SAPQPKPSLH 189
28872336  155 EVMEYMRVAPLLLFTEFNEP-AEPQPKPSLH 184
226946741 155 EVMEYLRVAPLLLFTECAGP-VAPAPKPSVH 184
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap