Conserved Protein Domain Family
PRK01844

?
PRK01844: PRK01844 
YneF family protein
Statistics
?
PSSM-Id: 100947
View PSSM: PRK01844
Aligned: 25 rows
Threshold Bit Score: 88.9189
Threshold Setting Gi: 152976058
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
154686204  1 MTLWVGILVGVVALLIGVALGFFIARKYMMSYLKKNPPINEQMLRMMMMQMGMKPSQKKINQMMKAMNNQAK 72 
225865663  1 MPIWLGILVGVVALVAGVALGFFIARKYMMNYLQKNPPINEQMLKMMMMQMGQKPSQKKINQMMSAMNKQQM 72 
301055170  1 MPIWLGILVGVVALVAGVALGFFIARKYMMNYLQKNPPINEQMLKMMMMQMGQKPSQKKINQMMSAMNKQQM 72 
52080413   1 MDLWVVILVGVLALLAGVALGFFIARKYMMNYLKKNPPINEQMLRMMMMQMGMKPSQKKINQMMKAMENQTK 72 
52785792   1 MDLWVVILVGVLALLAGVALGFFIARKYMMNYLKKNPPINEQMLRMMMMQMGMKPSQKKINQMMKAMENQTK 72 
296504180  1 MPIWLGILVGVVALVAGVALGFFIARKYMMNYLQKNPPINEQMLKMMMMQMGQKPSQKKINQMMSAMNKQQM 72 
163941285  1 MPMWLGILVGVVALVAGVALGFFIARKYMMNYLQKNPPINEQMLKMMMMQMGQKPSQKKINQMMSAMNKQQT 72 
305674524  1 MTLWVGILVGVVALLIGVALGFFIARKYMMSYLKKNPPINEQMLRMMMMQMGMKPSQKKINQMMKAMNNQTK 72 
16078854   1 MTLWVGILVGVVALLIGVALGFFIARKYMMSYLKKNPPINEQMLRMMMMQMGMKPSQKKINQMMKAMNNQTK 72 
49479439   1 MPIWLGILVGVVALVAGVALGFFIARKYMMNYLQKNPPINEQMLKMMMMQMGQKPSQKKINQMMSAMNKQQM 72 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap